Property Summary

NCBI Gene PubMed Count 37
PubMed Score 174.15
PubTator Score 125.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
Breast cancer -5.000 2.0e-16
breast carcinoma -2.600 1.7e-18
cutaneous lupus erythematosus -2.900 1.1e-02
cystic fibrosis 1.300 1.0e-02
esophageal adenocarcinoma -4.400 1.9e-02
invasive ductal carcinoma -3.244 1.6e-03
lung adenocarcinoma 1.700 4.0e-04
malignant mesothelioma -3.200 1.1e-07
non-small cell lung cancer 4.302 9.6e-15
psoriasis -1.800 4.7e-06

Gene RIF (14)

AA Sequence

MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGYGGGMRVCGFG      1 - 70
GGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDW     71 - 140
YQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELALRQGVEADIN    141 - 210
GLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMRE    211 - 280
QYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSL    281 - 350
AETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI    351 - 420
AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI                                      421 - 456
//

Text Mined References (39)

PMID Year Title