Property Summary

NCBI Gene PubMed Count 33
Grant Count 49
R01 Count 29
Funding $8,667,667.09
PubMed Score 163.43
PubTator Score 125.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (10)

Disease log2 FC p
malignant mesothelioma -3.200 0.000
esophageal adenocarcinoma -4.400 0.019
psoriasis -2.000 0.000
cutaneous lupus erythematosus -2.900 0.011
non-small cell lung cancer 4.302 0.000
cystic fibrosis 1.300 0.010
lung adenocarcinoma 1.700 0.000
invasive ductal carcinoma -3.244 0.002
Breast cancer -5.000 0.000
breast carcinoma -2.600 0.000

Gene RIF (13)

PMID Text
24260555 Cytokeratin 15 is upregulated in a subset of urothelial cell carcinomas.
22648550 K15 is expressed variably in both oral squamous cell carcinoma and squamous intraepithelial neoplasm
22538425 both expanded limbal NCs and HUVEC rejoined with LEPC to form spheres to upregulate expression of DeltaNp63alpha, CK15, and CEBPdelta, the former but not the latter abolished expression of CK12 keratin.
21574054 Stromal expression of KRT15, TCN1, and HOXB13 was significantly correlated with tumor grade, stromal hypercellularity, mitotic activity and microscopic borders.
21251039 CK15 highlights BZ cells in normal human follicles
20700038 Report expression of stem-cell markers cytokeratin 15 and nestin in primary adnexal neoplasms.
20656376 Physiological concentrations of thyroid hormones T3 and T4 enhance keratin 15 promoter activity and expression in epithelial stem cells of adult human scalp hair follicles in situ and in vitro.
20050020 KRT15 is a Gli1-responsive gene in human skin keratinocytes
20050020 KRT15 mRNA is selectively expressed in human hair follicle stem cells, while KRT15 protein is not.
19383306 Identification of a subset of breast carcinomas characterized by expression of CK15: relationship between CK15+ progenitor/amplified cells and pre-malignant lesions and invasive disease is reported.
More...

AA Sequence

MTTTFLQTSSSTFGGGSTRGGSLLAGGGGFGGGSLSGGGGSRSISASSARFVSSGSGGGYGGGMRVCGFG      1 - 70
GGAGSVFGGGFGGGVGGGFGGGFGGGDGGLLSGNEKITMQNLNDRLASYLDKVRALEEANADLEVKIHDW     71 - 140
YQKQTPTSPECDYSQYFKTIEELRDKIMATTIDNSRVILEIDNARLAADDFRLKYENELALRQGVEADIN    141 - 210
GLRRVLDELTLARTDLEMQIEGLNEELAYLKKNHEEEMKEFSSQLAGQVNVEMDAAPGVDLTRVLAEMRE    211 - 280
QYEAMAEKNRRDVEAWFFSKTEELNKEVASNTEMIQTSKTEITDLRRTMQELEIELQSQLSMKAGLENSL    281 - 350
AETECRYATQLQQIQGLIGGLEAQLSELRCEMEAQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMAGI    351 - 420
AIREASSGGGGSSSNFHINVEESVDGQVVSSHKREI                                      421 - 456
//

Text Mined References (35)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24260555 2013 Cytokeratin 15 marks basal epithelia in developing ureters and is upregulated in a subset of urothelial cell carcinomas.
22648550 2012 Expression of basal cell keratin 15 and keratin 19 in oral squamous neoplasms represents diverse pathophysiologies.
22538425 2012 Angiogenesis potential of human limbal stromal niche cells.
22458338 2012 Host-pathogen interactome mapping for HTLV-1 and -2 retroviruses.
22020285 2011 Image-based genome-wide siRNA screen identifies selective autophagy factors.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21574054 2012 Keratin 15, transcobalamin I and homeobox gene Hox-B13 expression in breast phyllodes tumors: novel markers in biological classification.
21269460 2011 Initial characterization of the human central proteome.
21251039 2011 Cytokeratin 15 expression in central, centrifugal, cicatricial alopecia: new observations in normal and diseased hair follicles.
More...