Property Summary

NCBI Gene PubMed Count 34
Grant Count 14
R01 Count 10
Funding $862,530.67
PubMed Score 264.20
PubTator Score 122.64

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.149 0.028
Multiple myeloma 1.758 0.001
pancreatic ductal adenocarcinoma liver m... -1.759 0.008
lung cancer 1.300 0.004
Pneumonia -1.300 0.015
ovarian cancer 1.700 0.001

Gene RIF (15)

PMID Text
24124598 Over-expression of the ATP5J gene correlates with cell migration and 5-fluorouracil sensitivity in colorectal cancer.
22190034 HIV-1 Vpu is identified to have a physical interaction with ATP synthase, H+ transporting, mitochondrial Fo complex, subunit F6 (ATP5J) in human HEK293 and/or Jurkat cell lines by using affinity tagging and purification mass spectrometry analyses
22038518 CF6 plays a crucial role in the development of insulin resistance and hypertension
20953793 The phenotypic range of retinal, peripheral and central nervous system disease expression is characterized in a single family with NARP syndrome from the ATPase 6 m.8993T>C mtDNA point mutation.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20811295 coupling factor 6 induces the development of systolic dysfunction and upregulation of nicotinamide adenine dinucleotide phosphate oxidase in the heart under the high-salt diet
19106112 Coupling factor 6 enhances Src-mediated responsiveness to angiotensin II in resistance arterioles and cells.
19064571 Observational study of gene-disease association. (HuGE Navigator)
18243211 in vascular endothelial cells both CF6 (coupling factor 6) and Angiotensin II downregulate PECAM-1 (platelet/endothelial cell adhesion molecule) expression via activation of c-Src kinase
17456993 Increased CF6 may be responsible in part for decreased prostacyclin observed in coronary heart disease, in particular after PTCA and stent therapy. Potential risk factor for coronary heart disease.
More...

AA Sequence

MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQE      1 - 70
LERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA                                     71 - 108
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24124598 2013 Over-expression of the ATP5J gene correlates with cell migration and 5-fluorouracil sensitivity in colorectal cancer.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22926577 2012 Quantitative proteomic analysis of human substantia nigra in Alzheimer's disease, Huntington's disease and Multiple sclerosis.
22038518 2012 Coupling factor 6-induced activation of ecto-F1F(o) complex induces insulin resistance, mild glucose intolerance and elevated blood pressure in mice.
21269460 2011 Initial characterization of the human central proteome.
20953793 2011 Heterogeneous patterns of tissue injury in NARP syndrome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
20833797 2011 Phosphoproteome analysis of functional mitochondria isolated from resting human muscle reveals extensive phosphorylation of inner membrane protein complexes and enzymes.
More...