Property Summary

NCBI Gene PubMed Count 35
PubMed Score 274.10
PubTator Score 122.64

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count Z-score Confidence
Heart Diseases 43 0.0 0.0

Expression

  Differential Expression (6)

Disease log2 FC p
lung cancer 1.300 3.5e-03
Multiple myeloma 1.758 5.1e-04
ovarian cancer 1.700 9.3e-04
pancreatic ductal adenocarcinoma liver m... -1.759 8.2e-03
Pneumonia -1.300 1.5e-02
Waldenstrons macroglobulinemia 1.149 2.8e-02

Gene RIF (16)

AA Sequence

MILQRLFRFSSVIRSAVSVHLRRNIGVTAVAFNKELDPIQKLFVDKIREYKSKRQTSGGPVDASSEYQQE      1 - 70
LERELFKLKQMFGNADMNTFPTFKFEDPKFEVIEKPQA                                     71 - 108
//

Text Mined References (41)

PMID Year Title