Property Summary

NCBI Gene PubMed Count 124
PubMed Score 415.01
PubTator Score 204.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytoma 1.100 1.1e-02
Gaucher disease type 1 -1.100 2.1e-02
osteosarcoma 1.214 3.4e-03
ovarian cancer -1.600 8.5e-09
pancreatic ductal adenocarcinoma liver m... -1.263 3.5e-02
Pick disease 1.100 1.3e-03
psoriasis -2.000 1.2e-04
Rheumatoid arthritis 1.700 5.1e-03

Protein-protein Interaction (1)

Gene RIF (87)

AA Sequence

MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLMPWE      1 - 70
SDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSN     71 - 140
SLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPAKTIIIQTVPT    141 - 210
LMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANS    211 - 280
PVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKK    281 - 350
ENGTLKRQLDEVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG    351 - 420
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLNHELRGWVHRH    421 - 490
EVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGSELQVYYASPRSYQDFFEAIR    491 - 560
RRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVINGQDYEVMMQIDCQVMDTRILHIKS    561 - 630
SSVPPYLRDQQRNQTNTFFGSPPAATEATHVVSTIPESLQ                                  631 - 670
//

Text Mined References (125)

PMID Year Title