Property Summary

NCBI Gene PubMed Count 114
Grant Count 134
R01 Count 104
Funding $18,033,405.99
PubMed Score 359.89
PubTator Score 204.47

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Rheumatoid Arthritis 1.700 0.005
psoriasis -2.000 0.000
osteosarcoma 1.214 0.003
astrocytoma 1.100 0.011
pancreatic ductal adenocarcinoma liver m... -1.263 0.035
Pick disease 1.100 0.001
ovarian cancer -1.600 0.000
Gaucher disease type 1 -1.100 0.021

Gene

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1390 screening 0 / 0 / 11 Determination of inhibition of thapsigargin-initiated ATF-6 protein induction in ER stress signaling.

Gene RIF (79)

PMID Text
26752648 results identify a role for DREAM silencing in the activation of ATF6 signaling, which promotes early neuroprotection in HD.
26707144 We found that HCS identified compounds which inhibited ATF6 nuclear translocation with high specificity, as confirmed by the luciferase reporter assay and western blot analysis
26261584 Endoplasmic reticulum stress related factor ATF6 and caspase-12 trigger apoptosis in neonatal hypoxic-ischemic encephalopathy.
26063662 autosomal recessive achromatopsia is caused by a frameshift mutation in ATF6 in this Pakistani family
26029869 A crucial and unexpected role for ATF6A in human foveal development and cone function.
25976933 These results confirm that HIV infection activates stress-response components and that antiretroviral therapy contributes to changes in the unfolded protein response activation profile.
25754093 Defective podocyte insulin signaling through p85-XBP1 promotes ATF6-dependent maladaptive ER-stress response in diabetic nephropathy.
25675914 protein expression were significantly higher in the placentas of women with early and late SPE than in the control women, whereas there were no differences in ATF6 and Ire1 mRNA and protein.
25593314 Data show that silver nanoparticles induce activating transcription factor-6 (ATF-6) degradation, leading to activation of the NLRP-3 inflammasome and pyroptosis.
25450523 our data demonstrate that CiC expression is activated during ER stress through the binding of ATF6alpha and XBP1 to an UPRE element located in the proximal promoter of Cic gene.
More...

AA Sequence

MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLMPWE      1 - 70
SDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSN     71 - 140
SLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQTNSSVPAKTIIIQTVPT    141 - 210
LMPLAKQQPIISLQPAPTKGQTVLLSQPTVVQLQAPGVLPSAQPVLAVAGGVTQLPNHVVNVVPAPSANS    211 - 280
PVNGKLSVTKPVLQSTMRNVGSDIAVLRRQQRMIKNRESACQSRKKKKEYMLGLEARLKAALSENEQLKK    281 - 350
ENGTLKRQLDEVVSENQRLKVPSPKRRVVCVMIVLAFIILNYGPMSMLEQDSRRMNPSVSPANQRRHLLG    351 - 420
FSAKEAQDTSDGIIQKNSYRYDHSVSNDKALMVLTEEPLLYIPPPPCQPLINTTESLRLNHELRGWVHRH    421 - 490
EVERTKSRRMTNNQQKTRILQGALEQGSNSQLMAVQYTETTSSISRNSGSELQVYYASPRSYQDFFEAIR    491 - 560
RRGDTFYVVSFRRDHLLLPATTHNKTTRPKMSIVLPAININENVINGQDYEVMMQIDCQVMDTRILHIKS    561 - 630
SSVPPYLRDQQRNQTNTFFGSPPAATEATHVVSTIPESLQ                                  631 - 670
//

Text Mined References (114)

PMID Year Title
27238082 2016 Compounds Triggering ER Stress Exert Anti-Melanoma Effects and Overcome BRAF Inhibitor Resistance.
26752648 2016 Activating transcription factor 6 derepression mediates neuroprotection in Huntington disease.
26707144 2016 High-content screening identifies inhibitors of the nuclear translocation of ATF6.
26261584 2015 ER stress related factor ATF6 and caspase-12 trigger apoptosis in neonatal hypoxic-ischemic encephalopathy.
26063662 2015 Mutation of ATF6 causes autosomal recessive achromatopsia.
26029869 2015 Mutations in the unfolded protein response regulator ATF6 cause the cone dysfunction disorder achromatopsia.
25976933 2015 HIV infection and antiretroviral therapy lead to unfolded protein response activation.
25754093 2015 Defective podocyte insulin signalling through p85-XBP1 promotes ATF6-dependent maladaptive ER-stress response in diabetic nephropathy.
25675914 2015 Expression of markers of endoplasmic reticulum stress-induced apoptosis in the placenta of women with early and late onset severe pre-eclampsia.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
More...