Property Summary

NCBI Gene PubMed Count 202
PubMed Score 618.15
PubTator Score 303.98

Knowledge Summary

Patent

No data available

Expression

Protein-protein Interaction (1)

Gene RIF (150)

AA Sequence

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSP      1 - 70
SNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNP     71 - 140
IGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKE    141 - 210
EDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDK    211 - 280
KLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRV    281 - 350
P//

Text Mined References (208)

PMID Year Title