Property Summary

NCBI Gene PubMed Count 174
Grant Count 238
R01 Count 161
Funding $19,780,708.02
PubMed Score 529.05
PubTator Score 303.98

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18848 Q9UH31 cAMP-dependent transcription factor ATF-4
Symbols CREB2
TXREB
CREB-2
TAXREB67

Gene

PDB

1CI6  

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1389 screening 2 / 0 / 9 Determination of inhibition of thapsigargin-initiated ATF-4 protein induction in ER stress signaling.

Gene RIF (131)

PMID Text
26884600 The activation of ATF4 in response to ONC201 required the kinases HRI and PKR, which phosphorylate and activate the translation initiation factor eIF2alpha.
26771712 Inhibition or overexpression of ATF4 confirms the role of ATF4 in SESN2 gene up-regulation induced by mitochondrial dysfunction.
26648175 ATF4 and ATF6beta act synergistically in the negative regulation of placental growth factor mRNA expression
26504039 Up-regulation of ATF4 is associated with Pancreatic Neuroendocrine Tumors.
26239904 TBL2 participates in ATF4 translation through its association with the mRNA.
26172539 a reduction of cell death was associated with decreased levels of ATF4 in a rhabdomyosarcoma cell line
26125799 Combined administration inhibited the cells most potently and time-dependently, decreased the expression of HO-1, and significantly increased the expression of ATF4, CHOP, and Ire-1 proteins expression levels
26111340 Global profiling in human mesenchymal stem cells and a novel cell-free assay reveals that ATF4 requires C/EBPbeta for genomic binding at a motif distinct from that bound by the C/EBPbeta homodimer.
26030745 This study outlines the mechanism of NIR laser phototoxicity and the utility of monitoring surface temperature and ATF4 expression as potential biomarkers to develop safe and effective clinical applications.
26011642 Upon loss of attachment in tumor cells, ATF4 activated a program of cytoprotective autophagy and antioxidant responses, including induced expression of heme oxygenase 1 (HO-1). Increased levels of HO-1 ameliorated oxidative stress and cell death.
More...

AA Sequence

MTEMSFLSSEVLVGDLMSPFDQSGLGAEESLGLLDDYLEVAKHFKPHGFSSDKAKAGSSEWLAVDGLVSP      1 - 70
SNNSKEDAFSGTDWMLEKMDLKEFDLDALLGIDDLETMPDDLLTTLDDTCDLFAPLVQETNKQPPQTVNP     71 - 140
IGHLPESLTKPDQVAPFTFLQPLPLSPGVLSSTPDHSFSLELGSEVDITEGDRKPDYTAYVAMIPQCIKE    141 - 210
EDTPSDNDSGICMSPESYLGSPQHSPSTRGSPNRSLPSPGVLCGSARPKPYDPPGEKMVAAKVKGEKLDK    211 - 280
KLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLIEEVRKARGKKRV    281 - 350
P//

Text Mined References (180)

PMID Year Title
26884600 2016 ONC201 kills solid tumor cells by triggering an integrated stress response dependent on ATF4 activation by specific eIF2? kinases.
26771712 2016 Mitochondrial dysfunction induces SESN2 gene expression through Activating Transcription Factor 4.
26648175 2016 Placental endoplasmic reticulum stress negatively regulates transcription of placental growth factor via ATF4 and ATF6?: implications for the pathophysiology of human pregnancy complications.
26504039 2015 Endoplasmic Reticulum Stress in Pancreatic Neuroendocrine Tumors is Linked to Clinicopathological Parameters and Possible Epigenetic Regulations.
26239904 2016 TBL2 Associates With ATF4 mRNA Via Its WD40 Domain and Regulates Its Translation During ER Stress.
26172539 2015 ATF4 mediates necrosis induced by glucose deprivation and apoptosis induced by 2-deoxyglucose in the same cells.
26125799 2015 Proapoptotic effects of heme oxygenase-1 inhibitor on Kasumi-1 cells via the ATF4/CHOP/Ire-1? pathway.
26111340 2015 ATF4 licenses C/EBP? activity in human mesenchymal stem cells primed for adipogenesis.
26086088 2015 Transcription Factor ATF4 Induces NLRP1 Inflammasome Expression during Endoplasmic Reticulum Stress.
26030745 2015 Molecular pathway of near-infrared laser phototoxicity involves ATF-4 orchestrated ER stress.
More...