Property Summary

NCBI Gene PubMed Count 67
Grant Count 74
R01 Count 42
Funding $7,399,564.7
PubMed Score 50.27
PubTator Score 117.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.718 0.002
Multiple myeloma 1.054 0.006
osteosarcoma 1.195 0.008
posterior fossa group A ependymoma 1.200 0.000
glioblastoma 1.100 0.000
group 3 medulloblastoma 1.300 0.011
Breast cancer 4.400 0.022
pediatric high grade glioma 1.300 0.000
atypical teratoid/rhabdoid tumor 1.200 0.000
primary Sjogren syndrome 1.100 0.005
ulcerative colitis -1.100 0.009
ovarian cancer -1.700 0.000
dermatomyositis 1.700 0.003

Synonym

Accession P18846 B4DRF9 P25168 Q9H4A8 cAMP-dependent transcription factor ATF-1
Symbols TREB36
EWS-ATF1
FUS/ATF-1

Gene

 GWAS Trait (1)

Gene RIF (36)

PMID Text
26149214 genetic association studies in a population in China: Data suggest that an SNP in ATF1 (rs11169571) is associated with essential hypertension in the population studied; altered binding of microRNA-1283 appears to be involved.
25359601 EWSR1-ATF1 fusion gene was found in hyalinizing clear cell carcinoma
24051143 Heme activates the ATF1 pathway in human macrophages via AMPK, and that a similar response occurs after treatment of cells with metformin.
22631637 ATF1 protein expression was significantly lower in colorectal cancer tissues than corresponding normal tissues; patients with higher ATF1 expression levels have a significantly higher survival rate than those with lower expression
22510762 Review: discuss clinicopathologic and molecular features of group of neoplasms unified by the presence of EWSR1-CREB1 and EWSR1-ATF1 genetic fusions.
22052915 ATF-1 mediates HO-1 induction by heme and drives macrophage adaptation to intraplaque hemorrhage.
21484932 Hyalinizing clear-cell carcinoma is a unique low-grade salivary carcinoma that consistently harbors EWSR1-ATF1 fusion.
20945072 Differential expression of CREB/ATF transcription factors could be observed on neurogenic induction, pointing to a decisive role of the cAMP-CREB/ATF system.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20536573 An increase in phosphorylation of CREB/ATF-1 in human dental pulp cells was noted after exposure to PGF2alpha for 1-20 min,with a maximal induction at 10 min.
More...

AA Sequence

MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKD      1 - 70
LSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSG     71 - 140
STQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTD    141 - 210
DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV             211 - 271
//

Text Mined References (75)

PMID Year Title
26149214 2015 The human ATF1 rs11169571 polymorphism increases essential hypertension risk through modifying miRNA binding.
25609649 2015 Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes.
25359601 2015 Hyalinizing clear cell carcinoma with EWSR1-ATF1 fusion gene: report of three cases with molecular analyses.
24737748 2014 Identification of susceptibility loci for colorectal cancer in a genome-wide meta-analysis.
24051143 2013 5'-AMP-activated protein kinase-activating transcription factor 1 cascade modulates human monocyte-derived macrophages to atheroprotective functions in response to heme or metformin.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22631637 2012 Activating transcription factor 1 is a prognostic marker of colorectal cancer.
22510762 2012 Tumors with EWSR1-CREB1 and EWSR1-ATF1 fusions: the current status.
22052915 2012 Activating transcription factor 1 directs Mhem atheroprotective macrophages through coordinated iron handling and foam cell protection.
21658281 2011 GWAS for discovery and replication of genetic loci associated with sudden cardiac arrest in patients with coronary artery disease.
More...