Property Summary

Ligand Count 8
NCBI Gene PubMed Count 73
PubMed Score 53.71
PubTator Score 117.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
atypical teratoid/rhabdoid tumor 1.100 5.7e-04
Breast cancer 4.400 2.2e-02
dermatomyositis 1.700 3.4e-03
ependymoma 1.100 1.2e-05
glioblastoma 1.100 3.8e-05
group 3 medulloblastoma 1.300 1.1e-02
Multiple myeloma 1.054 6.4e-03
osteosarcoma 1.195 7.8e-03
ovarian cancer -1.300 1.6e-02
pediatric high grade glioma 1.300 2.7e-04
primary Sjogren syndrome 1.100 4.6e-03
ulcerative colitis -1.100 9.1e-03
Waldenstrons macroglobulinemia 1.718 1.9e-03

Gene RIF (40)

AA Sequence

MEDSHKSTTSETAPQPGSAVQGAHISHIAQQVSSLSESEESQDSSDSIGSSQKAHGILARRPSYRKILKD      1 - 70
LSSEDTRGRKGDGENSGVSAAVTSMSVPTPIYQTSSGQYIAIAPNGALQLASPGTDGVQGLQTLTMTNSG     71 - 140
STQQGTTILQYAQTSDGQQILVPSNQVVVQTASGDMQTYQIRTTPSATSLPQTVVMTSPVTLTSQTTKTD    141 - 210
DPQLKREIRLMKNREAARECRRKKKEYVKCLENRVAVLENQNKTLIEELKTLKDLYSNKSV             211 - 271
//

Text Mined References (82)

PMID Year Title