Property Summary

NCBI Gene PubMed Count 287
PubMed Score 1806.22
PubTator Score 901.30

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Mesothelioma, Malignant 105 0.0 0.0
Disease Target Count
malignant mesothelioma 3232

Expression

  Differential Expression (28)

Disease log2 FC p
malignant mesothelioma 1.300 9.9e-06
adult high grade glioma 1.400 2.6e-05
atypical teratoid / rhabdoid tumor 2.000 1.3e-06
Breast cancer 1.700 2.1e-05
breast carcinoma 1.800 5.7e-03
cystic fibrosis 1.386 9.8e-05
ductal carcinoma in situ 3.000 2.4e-04
ependymoma 1.400 1.1e-03
fibroadenoma 2.200 4.1e-02
glioblastoma 1.500 2.2e-06
interstitial cystitis -1.900 6.9e-03
intraductal papillary-mucinous adenoma (... 1.800 9.8e-03
intraductal papillary-mucinous carcinoma... 2.000 3.3e-03
intraductal papillary-mucinous neoplasm ... 2.200 1.2e-02
invasive ductal carcinoma 2.450 7.1e-05
lung adenocarcinoma 1.500 2.0e-07
lung carcinoma -1.100 2.1e-20
medulloblastoma, large-cell 1.700 8.0e-04
nephrosclerosis -1.940 1.6e-02
non-small cell lung cancer 1.277 8.8e-13
osteosarcoma -2.830 2.3e-06
ovarian cancer 1.400 2.6e-03
pancreatic cancer 1.900 1.8e-09
primary pancreatic ductal adenocarcinoma 1.410 2.9e-02
primitive neuroectodermal tumor 2.100 2.7e-03
psoriasis -1.200 1.5e-04
sonic hedgehog group medulloblastoma 1.100 3.2e-02
spina bifida -1.671 3.2e-02

Gene RIF (257)

AA Sequence

MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQL      1 - 70
LTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHLASTT     71 - 140
TATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQD    141 - 210
FTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKK    211 - 280
KDEGSYSLEEPKQANGGAYQKPTKQEEFYA                                            281 - 310
//

Text Mined References (293)

PMID Year Title