Property Summary

NCBI Gene PubMed Count 270
Grant Count 558
R01 Count 331
Funding $242,546,323.95
PubMed Score 1682.04
PubTator Score 901.30

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18827 D6W523 Q53QV0 Q546D3 Q96HB7 SYND1
Symbols SDC
CD138
SYND1
syndecan

Gene

PDB

4GVC   4GVD  

 GWAS Trait (1)

Gene RIF (241)

PMID Text
26909794 The results suggest that Sdc1 may modulate fibronectin fibrillogenesis and/or alter cell morphology during ECM production through alphavbeta3 integrin, thereby mediating ECM fiber alignment.
26852939 Syndecan-1 on epithelial tumor cells promotes MIF binding and MIF-mediated cell migration. This may represent a relevant mechanism through which MIF enhances tumor cell motility and metastasis.
26729247 The new markers were able to identify a clonal CD138-negative population as minimal residual disease in the bone marrow and peripheral blood of MM patients.
26514209 miR-145 suppresses syndecan-1 and, by this mechanism, up-regulates stem cell factors and induces cell senescence and differentiation.
26513873 stromal changes in the expression of SDC-1 may originate from the stroma and contribute to the pathogenesis and metastatic potential of epithelial ovarian carcinoma
26460958 Targeting Syndecan-1, a molecule implicated in the process of vasculogenic mimicry, enhances the therapeutic efficacy of the L19-IL2 immunocytokine in human melanoma xenografts.
26350464 demonstrate that HER2 is captured via a site, comprised of amino acids 210-240, in the extracellular domain of human Sdc1, and EGFR is captured via an extracellular site comprised of amino acids 87-131 in human Sdc4
26289843 HPV16 particles binds to heparan sulfate and syndecan-1 molecules present in the extracellular matrix.
26210886 SULF1 levels are lower in pleural malignancies compared to benign conditions and inversely correlate with the amounts of syndecan-1, suggesting important roles for syndecan-1 and SULF1 in malignant mesothelioma.
26191180 miR-302a plays a key role in inhibition of ovarian cancer cell proliferation, and enhancing apoptosis by targeting SDC1.
More...

AA Sequence

MRRAALWLWLCALALSLQPALPQIVATNLPPEDQDGSGDDSDNFSGSGAGALQDITLSQQTPSTWKDTQL      1 - 70
LTAIPTSPEPTGLEATAASTSTLPAGEGPKEGEAVVLPEVEPGLTAREQEATPRPRETTQLPTTHLASTT     71 - 140
TATTAQEPATSHPHRDMQPGHHETSTPAGPSQADLHTPHTEDGGPSATERAAEDGASSQLPAAEGSGEQD    141 - 210
FTFETSGENTAVVAVEPDRRNQSPVDQGATGASQGLLDRKEVLGGVIAGGLVGLIFAVCLVGFMLYRMKK    211 - 280
KDEGSYSLEEPKQANGGAYQKPTKQEEFYA                                            281 - 310
//

Text Mined References (277)

PMID Year Title
26909794 2016 Syndecan-1-Induced ECM Fiber Alignment Requires Integrin ?v?3 and Syndecan-1 Ectodomain and Heparan Sulfate Chains.
26852939 2016 Cell surface syndecan-1 contributes to binding and function of macrophage migration inhibitory factor (MIF) on epithelial tumor cells.
26729247 2016 A CD138-independent strategy to detect minimal residual disease and circulating tumour cells in multiple myeloma.
26514209 2015 microRNA-145 promotes differentiation in human urothelial carcinoma through down-regulation of syndecan-1.
26513873 2015 Syndecan-1 serves as a marker for the progression of epithelial ovarian carcinoma.
26460958 2015 Targeting Syndecan-1, a molecule implicated in the process of vasculogenic mimicry, enhances the therapeutic efficacy of the L19-IL2 immunocytokine in human melanoma xenografts.
26350464 2015 Syndecan-1 and Syndecan-4 Capture Epidermal Growth Factor Receptor Family Members and the ?3?1 Integrin Via Binding Sites in Their Ectodomains: NOVEL SYNSTATINS PREVENT KINASE CAPTURE AND INHIBIT ?6?4-INTEGRIN-DEPENDENT EPITHELIAL CELL MOTILITY.
26289843 2015 Interaction of human papillomavirus type 16 particles with heparan sulfate and syndecan-1 molecules in the keratinocyte extracellular matrix plays an active role in infection.
26210886 2015 Syndecan-1 alters heparan sulfate composition and signaling pathways in malignant mesothelioma.
26191180 2015 MiR-302a inhibits the tumorigenicity of ovarian cancer cells by suppression of SDC1.
More...