Property Summary

NCBI Gene PubMed Count 89
PubMed Score 92.85
PubTator Score 118.40

Knowledge Summary

Patent (4,176)

TINX Plot

  Disease Sources (4)

Disease Target Count
Cardiomegaly 66
Fibrosis 40
Heart failure 80
Disease Target Count P-value
psoriasis 6685 1.64133527382842E-38
lung adenocarcinoma 2714 2.37895151452681E-7
malignant mesothelioma 3163 8.12262967758055E-7
ovarian cancer 8492 1.29345377060223E-5
lung cancer 4473 1.34034050243757E-5
glioblastoma 5572 1.76668374788425E-5
pediatric high grade glioma 2712 2.20128354268881E-5
primitive neuroectodermal tumor 3031 4.05557983646703E-4
breast carcinoma 1614 0.00249921806972368
non primary Sjogren syndrome sicca 840 0.0115786984794885
fibroadenoma 557 0.0216576827705772
astrocytoma 1493 0.0242525931286089
Disease Target Count Z-score Confidence
Gilles de la Tourette syndrome 47 3.305 1.7
Pain agnosia 99 3.213 1.6

Expression

  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 2.300 0.000
astrocytoma -1.100 0.024
glioblastoma -1.400 0.000
primitive neuroectodermal tumor -1.100 0.000
lung cancer 2.200 0.000
breast carcinoma -1.100 0.002
fibroadenoma -1.100 0.022
pediatric high grade glioma -1.300 0.000
non primary Sjogren syndrome sicca 1.100 0.012
lung adenocarcinoma -2.100 0.000
ovarian cancer 1.300 0.000
psoriasis -1.500 0.000

Synonym

Accession P18825 P35369 Q9HB49
Symbols ADRA2L2
ADRARL2
ADRA2RL2
ALPHA2CAR

Gene

PANTHER Protein Class (2)

  Ortholog (8)

Species Source
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Xenopus OMA Inparanoid
C. elegans EggNOG Inparanoid

  TechDev Info (1)

 CSPA Cell Line (3)

Gene RIF (80)

PMID Text
26427149 Common polymorphisms in the ADRA2C gene are not associated with orthostatic hypotension risk in Chinese.
26058836 ADRA2c is associated with heart rate recovery after exercise.
25406899 Adrenergic receptor genotype influences heart failure severity and beta-blocker response in children with dilated cardiomyopathy.
25110951 alpha2C-adrenoreceptor interaction with filamin-2
24676565 the ADRA2C 322-325I/D genotype is a novel genetic risk marker for SBI among individuals with hyperhomocysteinemia.
24643471 Genetic variants of ADRA2C do not alter intracellular localization or plasma membrane trafficking.
23868076 the region comprising the N-terminal half of The receptors contributed to the alpha2C-selectivity of drug binding.
23275278 Bucindolol prevents ventricular arrhythmias in subjects with heart failure and reduced left ventricular ejection fractions, and this effect is modulated by adrenergic alpha 2 receptor polymorphisms.
22560155 The ADRA2A and ADRA2C polymorphisms did not contribute to an increased risk of ischemic stroke or any pathophysiological subtype
22503931 the predicted signal peptide in the N-terminal tail of the alpha(2C)-adrenoceptor does not act as a cleavable signal peptide
More...

AA Sequence

MASPALAAALAVAAAAGPNASGAGERGSGGVANASGASWGPPRGQYSAGAVAGLAAVVGFLIVFTVVGNV      1 - 70
LVVIAVLTSRALRAPQNLFLVSLASADILVATLVMPFSLANELMAYWYFGQVWCGVYLALDVLFCTSSIV     71 - 140
HLCAISLDRYWSVTQAVEYNLKRTPRRVKATIVAVWLISAVISFPPLVSLYRQPDGAAYPQCGLNDETWY    141 - 210
ILSSCIGSFFAPCLIMGLVYARIYRVAKLRTRTLSEKRAPVGPDGASPTTENGLGAAAGAGENGHCAPPP    211 - 280
ADVEPDESSAAAERRRRRGALRRGGRRRAGAEGGAGGADGQGAGPGAAESGALTASRSPGPGGRLSRASS    281 - 350
RSVEFFLSRRRRARSSVCRRKVAQAREKRFTFVLAVVMGVFVLCWFPFFFSYSLYGICREACQVPGPLFK    351 - 420
FFFWIGYCNSSLNPVIYTVFNQDFRRSFKHILFRRRRRGFRQ                                421 - 462
//

Text Mined References (89)

PMID Year Title
26427149 2015 Association between Common Genetic Variants of ?2A-, ?2B-, and ?2C-Adrenergic Receptors and Orthostatic Hypotension.
26058836 2015 Genetic variation in alpha2-adrenoreceptors and heart rate recovery after exercise.
25406899 2015 Adrenergic receptor genotype influences heart failure severity and ?-blocker response in children with dilated cardiomyopathy.
25110951 2014 In silico modeling of human ?2C-adrenoreceptor interaction with filamin-2.
24676565 2014 Association between common genetic variants of ?2A-, ?2B- and ?2C-adrenoceptors and the risk of silent brain infarction.
24643471 2014 Common ?2A and ?2C adrenergic receptor polymorphisms do not affect plasma membrane trafficking.
23868076 2013 The C-terminal half of the ?2C-adrenoceptor determines the receptor's membrane expression level and drug selectivity.
23275278 2013 Adrenergic receptor polymorphisms and prevention of ventricular arrhythmias with bucindolol in patients with chronic heart failure.
22560155 2013 Association between common genetic variants of ?2A-, ?2B-, and ?2C-adrenergic receptors and ischemic stroke.
22503931 2012 The predicted N-terminal signal sequence of the human ??C-adrenoceptor does not act as a functional cleavable signal peptide.
More...