Property Summary

NCBI Gene PubMed Count 52
Grant Count 69
R01 Count 44
Funding $8,928,882.8
PubMed Score 121.01
PubTator Score 149.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
glioblastoma 1.600 0.000
group 3 medulloblastoma 1.800 0.000
atypical teratoid / rhabdoid tumor 1.600 0.000
medulloblastoma, large-cell 2.700 0.000
primitive neuroectodermal tumor 1.200 0.001
Atopic dermatitis 1.100 0.000
non-small cell lung cancer 1.385 0.000
colon cancer 1.600 0.001
lung cancer 1.400 0.000
pediatric high grade glioma 1.300 0.000
lung adenocarcinoma 1.600 0.000
inflammatory breast cancer 1.200 0.001
psoriasis 1.100 0.000

Synonym

Accession P18754 Q16269 Q6NT97
Symbols CHC1
RCC1-I
SNHG3-RCC1

Gene

PDB

5E1B   5E1D   5E1M   5E1O   5E2A   5E2B   1I2M   1A12  

Gene RIF (22)

PMID Text
26823742 RCC1 expression is frequently lost in poorly differentiated gastric cell lines and gastric carcinoma tissues. Loss of RCC1 expression is correlated with tumor differentiation and depth of invasion.
25452301 stress can disrupt the Ran gradients through RCC1-dependent and RCC1-independent mechanisms
25348717 PI3Kbeta regulates the nuclear envelope through upstream regulation of RCC1 and Ran
23536659 RCC1 facilitates a tight binding between the encephalomyocarditis virus leader and cellular Ran GTPase.
22944692 Positional proteomics analysis identifies the cleavage of human regulator of chromosome condensation 1 (RCC1) at amino acid residues 38-39 by the HIV-1 protease
22215983 RCC1 can induce bipolar spindle formation. Remarkably, RCC1 beads oscillate within spindles from pole to pole, a behavior that could be converted to a more typical, stable association by the addition of a kinesin together with RCC1.
20668449 discovery of the first alpha-N-methyltransferase, which we named N-terminal RCC1 methyltransferase (NRMT).
20347844 The authors find that RCC1 uses a conformationally flexible loop region we have termed the switchback loop in addition to its N-terminal tail to bind to the nucleosome.
19060893 Therefore, we propose that RCC1 reads the histone code created by caspase-activated Mst1 to initiate apoptosis by reducing the level of RanGTP in the nucleus.
18762580 The N-terminal tail of RCC1 is essential for association with DNA but inhibits histone binding.
More...

AA Sequence

MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV      1 - 70
QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV     71 - 140
FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL    141 - 210
FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC    211 - 280
FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV    281 - 350
ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ    351 - 420
S//

Text Mined References (58)

PMID Year Title
26871637 2016 Widespread Expansion of Protein Interaction Capabilities by Alternative Splicing.
26823742 2015 Methylation-silencing RCC1 expression is associated with tumorigenesis and depth of invasion in gastric cancer.
25452301 2015 Disruption of the ran system by cysteine oxidation of the nucleotide exchange factor RCC1.
25348717 2015 Phosphoinositide 3-kinase beta protects nuclear envelope integrity by controlling RCC1 localization and Ran activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23536659 2013 Guanine-nucleotide exchange factor RCC1 facilitates a tight binding between the encephalomyocarditis virus leader and cellular Ran GTPase.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22215983 2011 Mitotic spindle assembly around RCC1-coated beads in Xenopus egg extracts.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...