Property Summary

NCBI Gene PubMed Count 55
PubMed Score 142.48
PubTator Score 149.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Atopic dermatitis 1.100 8.2e-05
atypical teratoid / rhabdoid tumor 1.600 1.4e-06
colon cancer 1.600 1.5e-03
glioblastoma 1.100 2.6e-06
group 3 medulloblastoma 1.800 1.3e-04
inflammatory breast cancer 1.200 1.3e-03
lung adenocarcinoma 1.600 1.6e-11
lung cancer 1.400 4.1e-04
medulloblastoma, large-cell 2.700 2.3e-05
non-small cell lung cancer 1.385 4.1e-21
pediatric high grade glioma 1.300 2.2e-06
primitive neuroectodermal tumor 1.200 1.0e-03
psoriasis 1.100 1.3e-79

 GWAS Trait (1)

Gene RIF (24)

AA Sequence

MSPKRIAKRRSPPADAIPKSKKVKVSHRSHSTEPGLVLTLGQGDVGQLGLGENVMERKKPALVSIPEDVV      1 - 70
QAEAGGMHTVCLSKSGQVYSFGCNDEGALGRDTSVEGSEMVPGKVELQEKVVQVSAGDSHTAALTDDGRV     71 - 140
FLWGSFRDNNGVIGLLEPMKKSMVPVQVQLDVPVVKVASGNDHLVMLTADGDLYTLGCGEQGQLGRVPEL    141 - 210
FANRGGRQGLERLLVPKCVMLKSRGSRGHVRFQDAFCGAYFTFAISHEGHVYGFGLSNYHQLGTPGTESC    211 - 280
FIPQNLTSFKNSTKSWVGFSGGQHHTVCMDSEGKAYSLGRAEYGRLGLGEGAEEKSIPTLISRLPAVSSV    281 - 350
ACGASVGYAVTKDGRVFAWGMGTNYQLGTGQDEDAWSPVEMMGKQLENRVVLSVSSGGQHTVLLVKDKEQ    351 - 420
S//

Text Mined References (61)

PMID Year Title