Property Summary

NCBI Gene PubMed Count 36
PubMed Score 55.30
PubTator Score 44.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18669 Q9BWC0
Symbols PGAMA
PGAM-B
HEL-S-35

Gene

PDB

1LJD   1YFK   1YJX   4GPI   4GPZ  

Gene RIF (15)

PMID Text
26655504 Our finding showed that PGAM1 might serve as a promising therapeutic target for UBC.
26464696 PGAM1 is highly expressed in clear cell renal cell carcinoma and correlated with clinicalpathological features, which may contribute to tumor formation and progression.
25701843 PGAM1 correlates with spermatogenic dysfunction and affects the function of cell proliferation, apoptosis and migration.
25195573 PGAM is acetylated at lysines 100/106/113/138 in its central region, and a member of the Sirtuin family (class III deacetylase), SIRT2, is responsible for its deacetylation.
23653202 Tyrosine26 phosphorylation represents an additional acute mechanism underlying phosphoglycerate mutase 1 upregulation.
23153533 Phosphoglycerate mutase 1 (PGAM1) contributes to biosynthesis regulation by controlling intracellular levels of its substrate, 3-phosphoglycerate (3-PG), and product, 2-phosphoglycerate (2-PG).
22157007 PGAM1 deacetylation and activity are directly controlled by Sirt1.
20847263 histidine-phosphorylated PGAM1 correlated with expression of PKM2 in cancer cell lines; decreased pyruvate kinase activity in PKM2-expressing cells allows PEP-dependent histidine phosphorylation of PGAM1 and may provide an alternate glycolytic pathway
20471030 This protein has been found differentially expressed in thalami from patients with schizophrenia.
20403181 Our studies suggested that PGAM1 plays an important role in hepatocarcinogenesis
More...

AA Sequence

MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV      1 - 70
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR     71 - 140
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL    141 - 210
PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK                              211 - 254
//

Text Mined References (45)

PMID Year Title
26655504 2016 Proteomics identification of PGAM1 as a potential therapeutic target for urothelial bladder cancer.
26464696 2015 Expression of PGAM1 in renal clear cell carcinoma and its clinical significance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25701843 2015 PGAM1 is Involved in Spermatogenic Dysfunction and Affects Cell Proliferation, Apoptosis, and Migration.
25195573 2014 Deacetylation of phosphoglycerate mutase in its distinct central region by SIRT2 down-regulates its enzymatic activity.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23653202 2013 Tyr26 phosphorylation of PGAM1 provides a metabolic advantage to tumours by stabilizing the active conformation.
23533145 2013 In-depth proteomic analyses of exosomes isolated from expressed prostatic secretions in urine.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...