Property Summary

NCBI Gene PubMed Count 41
PubMed Score 62.59
PubTator Score 44.01

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18669 Q9BWC0
Symbols PGAMA
PGAM-B
HEL-S-35

Gene

PDB

1LJD   1YFK   1YJX   4GPI   4GPZ  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (20)

AA Sequence

MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV      1 - 70
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR     71 - 140
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL    141 - 210
PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK                              211 - 254
//

Text Mined References (50)

PMID Year Title