Property Summary

NCBI Gene PubMed Count 41
PubMed Score 62.59
PubTator Score 44.01

Knowledge Summary

Patent

No data available

Expression

Gene RIF (20)

AA Sequence

MAAYKLVLIRHGESAWNLENRFSGWYDADLSPAGHEEAKRGGQALRDAGYEFDICFTSVQKRAIRTLWTV      1 - 70
LDAIDQMWLPVVRTWRLNERHYGGLTGLNKAETAAKHGEAQVKIWRRSYDVPPPPMEPDHPFYSNISKDR     71 - 140
RYADLTEDQLPSCESLKDTIARALPFWNEEIVPQIKEGKRVLIAAHGNSLRGIVKHLEGLSEEAIMELNL    141 - 210
PTGIPIVYELDKNLKPIKPMQFLGDEETVRKAMEAVAAQGKAKK                              211 - 254
//

Text Mined References (50)

PMID Year Title