Property Summary

NCBI Gene PubMed Count 48
PubMed Score 331.08
PubTator Score 97.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
atypical teratoid / rhabdoid tumor 1.200 1.8e-06
Common variable immunodeficiency 1.185 3.8e-03
cutaneous lupus erythematosus 2.000 1.6e-03
medulloblastoma 1.100 7.0e-06
medulloblastoma, large-cell 1.200 9.2e-04
osteosarcoma -1.195 4.1e-03
psoriasis 1.700 3.0e-48

Gene RIF (40)

AA Sequence

MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSG      1 - 70
PPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPAR     71 - 140
RADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGR    141 - 210
VPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGL    211 - 280
PCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAI    281 - 350
ITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERL    351 - 420
LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGI    421 - 490
HPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL                                       491 - 525
//

Text Mined References (51)

PMID Year Title