Property Summary

NCBI Gene PubMed Count 36
Grant Count 96
R01 Count 49
Funding $8,682,029.05
PubMed Score 286.95
PubTator Score 97.23

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
cutaneous lupus erythematosus 2.000 0.002
osteosarcoma -1.195 0.004
medulloblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.200 0.000
medulloblastoma, large-cell 1.200 0.001
Common variable immunodeficiency 1.185 0.004
psoriasis 1.700 0.000

Synonym

Accession P18627 A8K7T9 Q7Z643 LAG-3
Symbols CD223

Gene

Gene RIF (28)

PMID Text
27053622 LAG-3 is highly expressed in peripheral blood CD8+ T cells in chronic HBV-infected patients.
26927558 Data indicate that in recurrent spontaneous abortion patients, the expression levels of CD49b and LAG-3 (CD223) on CD14(+) mononuclear cells and the plasma level of transforming growth factor beta (TGF-beta) decreased obviously compared with normal females.
26013006 An IL-27/Lag3 axis enhances Foxp3+ regulatory T cell-suppressive function and therapeutic efficacy.
25810006 iNKT cytokine production is profoundly altered by both HIV infection and treatment, and LAG-3, but not PD-1, expression is associated with a reduction in iNKT IFNgamma production.
25780040 the LAG-3/MHC class II pathway may synergize with PD-1/PD ligand to enhance T cell-mediated immune responses.
25154740 The elevated expression of LAG-3 at the genital tract suggests it may regulate T-cell activation, and identify cells susceptible to HIV infection. The enrichment of LAG-3 on double negative T cells suggests LAG-3 may contribute to the immunoregulatory activity of these cells.
25108024 LAG-3 trafficking from lysosomal compartments to the cell surface is dependent on the cytoplasmic domain through protein kinase C signaling in activated T cells.
25006012 NFKB1, CD27, LAG3 and IKZF3 are new susceptibility genes for psoriasis.
24441096 These results suggest that LAG-3-mediated activation of plasmacytoid dendritic cells takes place in vivo at tumor sites, and it is in part responsible for directing an immune-suppressive environment.
23261718 Expression of LAG-3 is coincident with the impaired effector function of HBV-specific CD8(+) T cell in HCC patients.
More...

AA Sequence

MWEAQFLGLLFLQPLWVAPVKPLQPGAEVPVVWAQEGAPAQLPCSPTIPLQDLSLLRRAGVTWQHQPDSG      1 - 70
PPAAAPGHPLAPGPHPAAPSSWGPRPRRYTVLSVGPGGLRSGRLPLQPRVQLDERGRQRGDFSLWLRPAR     71 - 140
RADAGEYRAAVHLRDRALSCRLRLRLGQASMTASPPGSLRASDWVILNCSFSRPDRPASVHWFRNRGQGR    141 - 210
VPVRESPHHHLAESFLFLPQVSPMDSGPWGCILTYRDGFNVSIMYNLTVLGLEPPTPLTVYAGAGSRVGL    211 - 280
PCRLPAGVGTRSFLTAKWTPPGGGPDLLVTGDNGDFTLRLEDVSQAQAGTYTCHIHLQEQQLNATVTLAI    281 - 350
ITVTPKSFGSPGSLGKLLCEVTPVSGQERFVWSSLDTPSQRSFSGPWLEAQEAQLLSQPWQCQLYQGERL    351 - 420
LGAAVYFTELSSPGAQRSGRAPGALPAGHLLLFLILGVLSLLLLVTGAFGFHLWRRQWRPRRFSALEQGI    421 - 490
HPPQAQSKIEELEQEPEPEPEPEPEPEPEPEPEQL                                       491 - 525
//

Text Mined References (39)

PMID Year Title
27053622 2016 [Elevated expression of lymphocyte activation gene-3 on peripheral blood CD8(+) T lymphocytes in patients with chronic hepatitis B virus infection].
26927558 2016 [Decreased expression levels of LAG-3 and CD49b on CD14+ cells in peripheral blood of patients with recurrent spontaneous abortion].
26013006 2016 An IL-27/Lag3 axis enhances Foxp3+ regulatory T cell-suppressive function and therapeutic efficacy.
25810006 2015 Elevated expression of LAG-3, but not PD-1, is associated with impaired iNKT cytokine production during chronic HIV-1 infection and treatment.
25780040 2015 The upregulation of LAG-3 on T cells defines a subpopulation with functional exhaustion and correlates with disease progression in HIV-infected subjects.
25154740 2014 Enrichment of LAG-3, but not PD-1, on double negative T cells at the female genital tract.
25108024 2014 Trafficking of LAG-3 to the surface on activated T cells via its cytoplasmic domain and protein kinase C signaling.
25006012 2014 Sequencing-based approach identified three new susceptibility loci for psoriasis.
24441096 2014 Alternative activation of human plasmacytoid DCs in vitro and in melanoma lesions: involvement of LAG-3.
23261718 2013 Expression of LAG-3 is coincident with the impaired effector function of HBV-specific CD8(+) T cell in HCC patients.
More...