Property Summary

NCBI Gene PubMed Count 45
PubMed Score 28.75
PubTator Score 39.31

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count Z-score Confidence
Macular degeneration 65 0.0 3.0
Disease Target Count Z-score Confidence
Kuhnt-Junius degeneration 14 3.214 1.6

Expression

  Differential Expression (4)

Disease log2 FC p
acute quadriplegic myopathy 1.126 7.1e-08
Multiple myeloma 1.272 2.6e-03
non primary Sjogren syndrome sicca 1.200 4.8e-02
ovarian cancer 1.700 3.8e-04

Protein-protein Interaction (5)

Gene RIF (26)

AA Sequence

MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVK      1 - 70
SGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSS     71 - 140
DRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSASPPRSRSRDRSHERNRDRDRDRERDRDRDR    141 - 210
DRDRERDRDRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAF    211 - 280
SPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAV    281 - 350
QNSPKGCHRDKRTQIVYSDDVYKENLVDGF                                            351 - 380
//

Text Mined References (59)

PMID Year Title