Property Summary

NCBI Gene PubMed Count 44
Grant Count 1
Funding $128,491.33
PubMed Score 27.62
PubTator Score 39.31

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.272 0.003
acute quadriplegic myopathy 1.126 0.000
non primary Sjogren syndrome sicca 1.200 0.048
ovarian cancer 1.700 0.000

Synonym

Accession P18615 A2BE08 B4DUN1 B4DYX9 Q5JP74 Q5JP75 Q96F56 Q9NPK2 NELF-E
Symbols RD
RDP
RDBP
D6S45
NELF-E

Gene

 Grant Application (1)

PDB

1X5P   2BZ2   2JX2  

Gene RIF (27)

PMID Text
26504077 novel actions of BRD4 and of NELF-E in GR-controlled gene induction have been uncovered.
24636995 Following NELF-E knockdown or tumor necrosis factor alpha stimulation, promoter-proximal RNAP II levels increase up to 3-fold, and there is a dramatic increase in RNAP II levels within the HIV genome.
24636995 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
24636995 Knockdown of NELF-E by shRNA enhances HIV-1 transcription in latently infected cells
24453987 these results describe the RNA binding behavior of NELF-E and supports a biological role for NELF-E in promoter-proximal pausing of both HIV-1 and cellular genes.
24158816 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
22740393 the transcription elongation of KSHV OriLytL-K7 lytic genes is inhibited by NELF during latency, but can also be promptly reactivated in an RTA-independent manner upon external stimuli
22614758 Multivariate analysis revealed that RDBP protein levels were an independent risk factor for early intrahepatic recurrence of HCC within 2 years of surgery.
20471948 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
20471948 NELF represses HIV-1 transcription by pausing the RNA polymerase II complex
More...

AA Sequence

MLVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLSEQPVMDTATATEQAKQLVK      1 - 70
SGAISAIKAETKNSGFKRSRTLEGKLKDPEKGPVPTFQPFQRSISADDDLQESSRRPQRKSLYESFVSSS     71 - 140
DRLRELGPDGEEAEGPGAGDGPPRSFDWGYEERSGAHSSASPPRSRSRDRSHERNRDRDRDRERDRDRDR    141 - 210
DRDRERDRDRDRDRDRDRERDRDRERDRDRDREGPFRRSDSFPERRAPRKGNTLYVYGEDMTPTLLRGAF    211 - 280
SPFGNIIDLSMDPPRNCAFVTYEKMESADQAVAELNGTQVESVQLKVNIARKQPMLDAATGKSVWGSLAV    281 - 350
QNSPKGCHRDKRTQIVYSDDVYKENLVDGF                                            351 - 380
//

Text Mined References (57)

PMID Year Title
26504077 2016 Kinetically Defined Mechanisms and Positions of Action of Two New Modulators of Glucocorticoid Receptor-regulated Gene Induction.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
25416956 2014 A proteome-scale map of the human interactome network.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24636995 2014 Negative elongation factor is required for the maintenance of proviral latency but does not induce promoter-proximal pausing of RNA polymerase II on the HIV long terminal repeat.
24453987 2014 Defining NELF-E RNA binding in HIV-1 and promoter-proximal pause regions.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23577725 2013 Genetic factors in nonsmokers with age-related macular degeneration revealed through genome-wide gene-environment interaction analysis.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22740393 2012 Negative elongation factor-mediated suppression of RNA polymerase II elongation of Kaposi's sarcoma-associated herpesvirus lytic gene expression.
More...