Property Summary

NCBI Gene PubMed Count 85
PubMed Score 1046.76
PubTator Score 198.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
group 4 medulloblastoma 1.100 2.0e-04
mucosa-associated lymphoid tissue lympho... 1.835 2.4e-02
osteosarcoma -5.140 1.6e-08
ovarian cancer 1.100 5.2e-08
spina bifida -1.124 3.7e-02

Gene RIF (52)

AA Sequence

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAALGLGFLTSNFR      1 - 70
RHSWSSVAFNLFMLALGVQWAILLDGFLSQFPPGKVVITLFSIRLATMSAMSVLISAGAVLGKVNLAQLV     71 - 140
VMVLVEVTALGTLRMVISNIFNTDYHMNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAM    141 - 210
LGALFLWMFWPSVNSPLLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYVHSAVLAGGVA    211 - 280
VGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPVCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLH    281 - 350
TVWNGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF       351 - 417
//

Text Mined References (87)

PMID Year Title