Property Summary

NCBI Gene PubMed Count 82
Grant Count 41
R01 Count 18
Funding $20,740,715.64
PubMed Score 993.61
PubTator Score 198.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -5.140 0.000
group 4 medulloblastoma 1.100 0.000
spina bifida -1.124 0.037
mucosa-associated lymphoid tissue lympho... 1.835 0.024
ovarian cancer 1.100 0.000

Gene RIF (50)

PMID Text
26579938 The RHCE gene intron 4 of Han Chinese, Tibetans, and Mongols differs from the RHD gene intron 4 in the presence of a 652-bp fragment.
26435076 Six new RHCE alleles were identified, namely, RHCE*cE84A, RHCE*ce202G, RHCE*ce307T, RHCE*Ce377G, RHCE*ce697G,712G,733G,744C, and RHCE*Ce733G in individuals of diverse racial origin.
26286238 RHCE*cE94G encodes variable expression of c (RH4).
25857637 An uneven distribution of RH variant alleles between Dogon and Fulani, in Mali. A high incidence of predicted partial-C phenotype encoded by RHCE*Ce-D(4)-ce was found in Fulani.
25695437 One allele was found to be the known allele RHCE*Ol.20.01(RHCE*ce733G) and the second was novel: RHCE*Ol.06.02(RHCE*ce254G,733G).
25582271 Through molecular genotyping we also identified polymorphisms in RhCE, Kell, Duffy, Colton, Lutheran and Scianna loci in donors and patients.
24960646 Rh antibodies in SCD patients with RH variants can be clinically significant and, therefore, matching patients based on RH variants should be considered.
24333089 These data showed the presence of the (C)ce(s) haplotype at a low frequency (0.625%) compared to that among Africans in whom it is common. Nevertheless, the presence of RHD-CE-D(s) in Tunisians, even at a lower frequency
24033223 Frequencies of aberrant RHD and RHCE alleles were similar, irrespective of location and ethnicity.
23772606 RHCE*ceMO was present in one in 50 African-American persons with an allele frequency of 0.01, is often linked to RHD*DAU0, and is potentially of clinical significance for transfusion.
More...

AA Sequence

MSSKYPRSVRRCLPLWALTLEAALILLFYFFTHYDASLEDQKGLVASYQVGQDLTVMAALGLGFLTSNFR      1 - 70
RHSWSSVAFNLFMLALGVQWAILLDGFLSQFPPGKVVITLFSIRLATMSAMSVLISAGAVLGKVNLAQLV     71 - 140
VMVLVEVTALGTLRMVISNIFNTDYHMNLRHFYVFAAYFGLTVAWCLPKPLPKGTEDNDQRATIPSLSAM    141 - 210
LGALFLWMFWPSVNSPLLRSPIQRKNAMFNTYYALAVSVVTAISGSSLAHPQRKISMTYVHSAVLAGGVA    211 - 280
VGTSCHLIPSPWLAMVLGLVAGLISIGGAKCLPVCCNRVLGIHHISVMHSIFSLLGLLGEITYIVLLVLH    281 - 350
TVWNGNGMIGFQVLLSIGELSLAIVIALTSGLLTGLLLNLKIWKAPHVAKYFDDQVFWKFPHLAVGF       351 - 417
//

Text Mined References (84)

PMID Year Title
26579938 2016 Intron 4 of the RH Gene in Han Chinese, Tibetan, and Mongol Populations.
26435076 2016 Identification of six new RHCE variant alleles in individuals of diverse racial origin.
26286238 2015 RHCE*cE94G encodes variable expression of c (RH4).
25857637 2015 RH diversity in Mali: characterization of a new haplotype RHD*DIVa/RHCE*ceTI(D2).
25695437 2014 RHCE variant allele: RHCE*ce254G,733G.
25582271 2015 Erythrocyte genotyping for transfusion-dependent patients at the Azienda Universitaria Policlinico of Naples.
24960646 2015 Variant RH alleles and Rh immunisation in patients with sickle cell disease.
24333089 2014 (C)ce(s) haplotype screening in Tunisian blood donors.
24033223 2013 A comprehensive survey of both RHD and RHCE allele frequencies in sub-Saharan Africa.
23772606 2013 RHCE*ceMO is frequently in cis to RHD*DAU0 and encodes a hr(S) -, hr(B) -, RH:-61 phenotype in black persons: clinical significance.
More...