Property Summary

NCBI Gene PubMed Count 91
PubMed Score 50.68
PubTator Score 28.76

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18564 B2R9W5 C9JA97 Q0VA95 Q16500 Q53RG5 Q53RR6
Symbols AI1H

Gene

PDB

4UM9   4UM8   1LH9  

 GO Function (1)

Gene RIF (59)

PMID Text
26901152 Integrins alphavbeta6 and alphavbeta8 were expressed in non-overlapping patterns by keratinocytes and maintained the epidermal residence of Langerhans cells and tissue resident memory T cells by activating latent TGF-beta.
26861876 These data reveal a novel role for Elk1 regulating ITGB6 expression and highlight how dysregulation of Elk1 can contribute to human disease.
26663660 In this study, the long binding helix of this ligand was downsized to an enzymatically stable cyclic peptide endowed with sub-nanomolar binding affinity toward the alphavbeta6 receptor and remarkable selectivity against other integrins
26157134 Herpes simplex virus entry is enabled by gH/gL interaction with alphavbeta6- or alphavbeta8-integrin receptors.
26134759 The results indicated that MMP-9-degraded Fibronectin can adjust constituents of the avb6 heterodimers at the early phase and significantly elevate amounts of b6 integrin subunits at a later period
25982998 targeting eIF4E in integrin ava6 expressing tumors can be a potential therapeutic strategy for patients with colon cancer.
25816241 Results shows that ITGB6 promoter contains a functional TATA box and that STAT3 and C/EBPalpha are involved in its positive regulation in oral squamous cell carcinoma cells.
25745053 high levels of alphavbeta6 integrin may identify a specific endotype of progressive fibrotic lung disease
25339175 Data indicate that influenza A virus H1N1 infection activated alphavbeta6 integrin-dependent transforming growth factor beta (TGFbeta) activity in immortalized bronchial epithelial cells (iHBEC).
25150423 Expression of the alphavbeta6 integrin subunit seems to be of pathobiological and clinical relevance in patients with non-small cell lung cancer with brain metastases.
More...

AA Sequence

MGIELLCLFFLFLGRNDHVQGGCALGGAETCEDCLLIGPQCAWCAQENFTHPSGVGERCDTPANLLAKGC      1 - 70
QLNFIENPVSQVEILKNKPLSVGRQKNSSDIVQIAPQSLILKLRPGGAQTLQVHVRQTEDYPVDLYYLMD     71 - 140
LSASMDDDLNTIKELGSRLSKEMSKLTSNFRLGFGSFVEKPVSPFVKTTPEEIANPCSSIPYFCLPTFGF    141 - 210
KHILPLTNDAERFNEIVKNQKISANIDTPEGGFDAIMQAAVCKEKIGWRNDSLHLLVFVSDADSHFGMDS    211 - 280
KLAGIVIPNDGLCHLDSKNEYSMSTVLEYPTIGQLIDKLVQNNVLLIFAVTQEQVHLYENYAKLIPGATV    281 - 350
GLLQKDSGNILQLIISAYEELRSEVELEVLGDTEGLNLSFTAICNNGTLFQHQKKCSHMKVGDTASFSVT    351 - 420
VNIPHCERRSRHIIIKPVGLGDALELLVSPECNCDCQKEVEVNSSKCHHGNGSFQCGVCACHPGHMGPRC    421 - 490
ECGEDMLSTDSCKEAPDHPSCSGRGDCYCGQCICHLSPYGNIYGPYCQCDNFSCVRHKGLLCGGNGDCDC    491 - 560
GECVCRSGWTGEYCNCTTSTDSCVSEDGVLCSGRGDCVCGKCVCTNPGASGPTCERCPTCGDPCNSKRSC    561 - 630
IECHLSAAGQAREECVDKCKLAGATISEEEDFSKDGSVSCSLQGENECLITFLITTDNEGKTIIHSINEK    631 - 700
DCPKPPNIPMIMLGVSLAILLIGVVLLCIWKLLVSFHDRKEVAKFEAERSKAKWQTGTNPLYRGSTSTFK    701 - 770
NVTYKHREKQKVDLSTDC                                                        771 - 788
//

Text Mined References (95)

PMID Year Title
26901152 2016 Stromal cells control the epithelial residence of DCs and memory T cells by regulated activation of TGF-?.
26861876 2016 Reduced Ets Domain-containing Protein Elk1 Promotes Pulmonary Fibrosis via Increased Integrin ?v?6 Expression.
26663660 2016 Stable Peptides Instead of Stapled Peptides: Highly Potent ?v?6-Selective Integrin Ligands.
26157134 2015 Dissociation of HSV gL from gH by ?v?6- or ?v?8-integrin promotes gH activation and virus entry.
26134759 2015 Binding of MMP-9-degraded fibronectin to ?6 integrin promotes invasion via the FAK-Src-related Erk1/2 and PI3K/Akt/Smad-1/5/8 pathways in breast cancer.
25982998 2015 Integrin ?6 can be translationally regulated by eukaryotic initiation factor 4E: Contributing to colonic tumor malignancy.
25816241 2015 Cloning and characterization of the human integrin ?6 gene promoter.
25745053 2015 ?v?6 integrin may be a potential prognostic biomarker in interstitial lung disease.
25339175 2014 Influenza promotes collagen deposition via ?v?6 integrin-mediated transforming growth factor ? activation.
25150423 2014 ?v?3, ?v?5 and ?v?6 integrins in brain metastases of lung cancer.
More...