Property Summary

NCBI Gene PubMed Count 24
Grant Count 12
R01 Count 11
Funding $748,618.33
PubMed Score 20.08
PubTator Score 8.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
psoriasis 1.900 0.000
medulloblastoma, large-cell 1.300 0.027

Gene RIF (5)

PMID Text
20979602 Collectively, we report previously unrecognized PDE6 expression in human lungs, significant alterations of the PDE6D and PDE6G/H subunits in IPF lungs.
20655036 These findings demonstrate the positive role of the gamma subunit in maintaining phosphodiesterase activity and confirm the contribution of PDE6G to the etiology of retinitis pigmentosa in humans.
20397626 The C-terminus of PED gamma occludes the active site of PDE6, thereby preventing hydrolysis of cGMP.
19798052 Crystal structures of a chimaeric PDE5/PDE6 catalytic domain (PDE5/6cd) complexed with sildenafil or 3-isobutyl-1-methylxanthine and the Pgamma-inhibitory peptide Pgamma(70-87) have been determined at 2.9 and 3.0 A, respectively.
12624098 PDEG functions to link c-Src and G-protein-coupled receptor kinase 2 in a signaling unit that regulates p42/p44 mitogen-activated protein kinase by epidermal growth factor

AA Sequence

MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW      1 - 70
EAFNHLELHELAQYGII                                                          71 - 87
//

Text Mined References (24)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
20979602 2010 Phosphodiesterase 6 subunits are expressed and altered in idiopathic pulmonary fibrosis.
20655036 2010 Autosomal-recessive early-onset retinitis pigmentosa caused by a mutation in PDE6G, the gene encoding the gamma subunit of rod cGMP phosphodiesterase.
20397626 2010 Determinants for phosphodiesterase 6 inhibition by its gamma-subunit.
19798052 2009 Structural basis of phosphodiesterase 6 inhibition by the C-terminal region of the gamma-subunit.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16381901 2006 The LIFEdb database in 2006.
16357825 2005 The regulatory subunit of PDE6 interacts with PACSIN in photoreceptors.
15489336 2004 From ORFeome to biology: a functional genomics pipeline.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...