Property Summary

Ligand Count 1
NCBI Gene PubMed Count 24
PubMed Score 19.20
PubTator Score 8.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Retinitis Pigmentosa 226 4.162 2.1
RETINITIS PIGMENTOSA 57 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 8.0e-05
medulloblastoma, large-cell 6241 2.7e-02
Disease Target Count Z-score Confidence
Familial Retinoblastoma 4 4.96 2.5
Cystoid macular edema 6 3.047 1.5

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell 1.300 2.7e-02
psoriasis 1.900 8.0e-05

Protein-protein Interaction (2)

Gene RIF (5)

AA Sequence

MNLEPPKAEFRSATRVAGGPVTPRKGPPKFKQRQTRQFKSKPPKKGVQGFGDDIPGMEGLGTDITVICPW      1 - 70
EAFNHLELHELAQYGII                                                          71 - 87
//

Text Mined References (24)

PMID Year Title