Property Summary

Ligand Count 1
NCBI Gene PubMed Count 940
PubMed Score 1215.75
PubTator Score 1969.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Keratoconus 113 0.0 5.0
Disease Target Count
Gastric Cancer, Hereditary Diffuse 12

Expression

  Differential Expression (25)

Disease log2 FC p
psoriasis 1.500 4.9e-07
tuberculosis -2.600 1.5e-04
active ulcerative colitis 2.500 4.4e-02
adult high grade glioma 1.200 1.6e-04
Astrocytoma, Pilocytic 1.300 1.4e-03
atypical teratoid / rhabdoid tumor 1.100 1.4e-03
colon cancer 1.900 2.1e-02
COPD -1.700 4.2e-03
cystic fibrosis 1.300 1.5e-03
ductal carcinoma in situ 1.700 3.6e-02
esophageal adenocarcinoma -2.700 2.7e-02
glioblastoma 1.100 2.8e-04
interstitial cystitis -2.200 2.5e-02
intraductal papillary-mucinous adenoma (... 2.300 1.6e-03
intraductal papillary-mucinous neoplasm ... 3.900 1.2e-03
invasive ductal carcinoma 1.500 4.9e-02
lung cancer -1.800 7.8e-05
lung carcinoma -1.500 4.2e-09
Obesity 1.200 3.3e-02
osteosarcoma -2.588 7.9e-03
pancreatic cancer 2.800 3.1e-08
posterior fossa group A ependymoma 1.500 5.0e-06
primary pancreatic ductal adenocarcinoma 1.343 4.8e-02
spina bifida -1.092 3.9e-02
urothelial carcinoma -1.600 1.5e-03

Protein-protein Interaction (1)

Gene RIF (1040)

AA Sequence

MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEK      1 - 70
IDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAA     71 - 140
CPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE                                     141 - 177
//

Text Mined References (946)

PMID Year Title