Property Summary

NCBI Gene PubMed Count 914
Grant Count 540
R01 Count 256
Funding $54,144,390.53
PubMed Score 1128.08
PubTator Score 1969.46

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (88)

Disease Z-score Confidence
Arthritis 248 6.022 3.0
Schnitzler syndrome 3 5.957 3.0
Muckle-Wells syndrome 11 5.35 2.7
Erdheim-Chester disease 5 4.981 2.5
Exanthem 39 4.905 2.5
Pericarditis 14 4.694 2.3
Mevalonic aciduria 12 4.371 2.2
Urticaria 53 4.294 2.1
Hidradenitis suppurativa 12 4.158 2.1
Hypersensitivity reaction type II diseas... 235  4.044 2.0
Amyloidosis 68 4.038 2.0
Gastritis 44 3.816 1.9
Periostitis 5 3.658 1.8
Vasculitis 64 3.654 1.8
Cancer 2,346 3.532 1.8
periodontitis 269 3.51 1.8
Psoriatic arthritis 83 3.44 1.7
Uveitis 103 3.433 1.7
Arthropathy 34 3.411 1.7
Ankylosing spondylitis 138 3.379 1.7
SAPHO syndrome 10 3.283 1.6
Dermatitis 107 3.246 1.6
Duodenal ulcer 20 3.232 1.6
Hemophagocytic lymphohistiocytosis 30 3.174 1.6
psoriasis 6,685 3.173 1.6
tuberculosis 1,557 3.146 1.6
Osteomyelitis 20 3.068 1.5
Inflammatory bowel disease 142 3.067 1.5
Sensorineural hearing loss 107 3.015 1.5
Lung disease 132 3.005 1.5
Anorexia 15
Anthracosis 4
Arsenic Poisoning 59
Asthma 349
Atrophic 10
Autistic Disorder 320
Brain Ischemia 87
Bronchial Hyperreactivity 13
COPD 113
Cerebrovascular accident 44
Colonic Neoplasms 126
Cryopyrin associated periodic syndrome 5
Dermatologic disorders 65
Diarrhea 155
Extravasation of Diagnostic and Therapeu... 6 
Fibrosis 40
Hyperalgesia 71
INTERLEUKIN 1 RECEPTOR ANTAGONIST DEFICI... 1 
Inflammation 109
Inflammatory disease of mucous membrane 8
Juvenile arthritis 124
Kidney Diseases 86
Learning Disorders 27
Liver Failure, Acute 22
MICROVASCULAR COMPLICATIONS OF DIABETES,... 1 
Myocardial Infarction 126
Myositis 24
Necrosis 51
Obesity 616
Pain 70
Peripheral Neuropathy 303
Prostatic Neoplasms 471
Proteinuria 63
Rheumatoid Arthritis 1,160
Sclerosis 1
Status Epilepticus 85
Stomach Neoplasms 282
adult high grade glioma 2,148
atypical teratoid / rhabdoid tumor 4,369
colon cancer 1,475
cystic fibrosis 1,665
ductal carcinoma in situ 1,745
esophageal adenocarcinoma 737
glioblastoma 5,572
interstitial cystitis 2,299
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung cancer 4,466
lung carcinoma 2,844
osteosarcoma 7,933
pancreatic cancer 2,300
pilocytic astrocytoma 3,086
posterior fossa group A ependymoma 1,511
primary pancreatic ductal adenocarcinoma 1,271
spina bifida 1,064
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

  Differential Expression (25)

Disease log2 FC p
urothelial carcinoma -1.600 0.001
esophageal adenocarcinoma -3.200 0.030
psoriasis 1.800 0.000
osteosarcoma -2.588 0.008
glioblastoma 1.200 0.000
atypical teratoid / rhabdoid tumor 1.100 0.001
tuberculosis -2.800 0.000
primary pancreatic ductal adenocarcinoma 1.343 0.048
intraductal papillary-mucinous adenoma (... 2.300 0.002
intraductal papillary-mucinous neoplasm ... 3.900 0.001
colon cancer 2.100 0.016
lung cancer -3.400 0.041
ulcerative colitis 4.100 0.000
pancreatic cancer 2.800 0.000
Obesity 1.200 0.033
interstitial cystitis -2.200 0.025
cystic fibrosis 1.300 0.002
adult high grade glioma 1.200 0.000
pilocytic astrocytoma 1.300 0.002
posterior fossa group A ependymoma 1.500 0.000
COPD -1.900 0.003
lung carcinoma -1.500 0.000
spina bifida -1.092 0.039
ductal carcinoma in situ 1.700 0.036
invasive ductal carcinoma 1.500 0.049

Synonym

Accession P18510 A8K4G1 Q14628 Q53SC2 Q7RTZ4 Q96GD6 Q9UPC0 IL-1RN
Symbols DIRA
IRAP
IL1F3
IL1RA
MVCD4
IL-1RN
IL-1ra
IL-1ra3
ICIL-1RA

Gene

PDB

1IRA   1ILR   1ILT   1IRP   1ITN   2IRT  

 GWAS Trait (1)

Gene RIF (1015)

PMID Text
27116880 Exposure to nosocomial pneumonia associated with haplotypes IL-1RN * 4-IL-1beta (-511) C-->T gene of the same name cytokines having polar biological effects.
26972847 While both contributing to pathogen clearance, NLRP3 more than NLRC4 contributes to deleterious inflammatory responses in cystic fibrosis and correlates with defective NLRC4-dependent IL-1Ra production.
26861613 The IL-4 rs79071878 polymorphism, was associated whereas the IL-1Ra rs2234663 polymorphism was not associated with Familial Mediterranean Fever risk in the Turkish population.
26813462 This study shows a significant association between IL-1 RA allele distribution and febrile convulsions
26612588 IL-1Ra can be a useful tool in the diagnosis of hepatic inflammation.
26610735 These data suggest that M. leprae upregulates IL-1Ra by a TOLLIP-dependent mechanism; inhibition of TOLLIP may decrease an individual's susceptibility to leprosy and offer a novel therapeutic target for IL-1-dependent diseases.
26521731 the lower expression of IL10 and the higher expression of IL1RA in Mo exposed to arthritic than to non-arthritic SF suggest that arthritic SF is mainly reducing the inflammatory responses in Mo.
26502861 This study emphasizes a positive association between IL1-Ra (VNTR) polymorphism and DM among Saudi children. This may suggest that (A2) allele may play important role in disease susceptibility.
26487586 Serum IL1RA and IL2RA are predictors of event free survival in T-cell lymphoma.
26474296 IL-1Ra is associated with MMP-13 expression and has a novel function in such regulation without interference of the IL-1 signaling cascade.
More...

AA Sequence

MEICRGLRSHLITLLLFLFHSETICRPSGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEK      1 - 70
IDVVPIEPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAA     71 - 140
CPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE                                     141 - 177
//

Text Mined References (920)

PMID Year Title
27116880 [Polymorphism of genes of interleukin-1 family as factor of pathogenesis of nozokomialny pneumonia].
26972847 2016 IL-1 receptor antagonist ameliorates inflammasome-dependent inflammation in murine and human cystic fibrosis.
26861613 2016 Interleukin-1Ra rs2234663 and Interleukin-4 rs79071878 Polymorphisms in Familial Mediterranean Fever.
26813462 2016 Does the imbalance between agonistic and antagonistic IL-1 play a role in progression of febrile convulsions?
26612588 2015 Plasma IL-1 receptor antagonist levels correlate with the development of non-alcoholic steatohepatitis.
26610735 2016 Genetic Variation in Toll-Interacting Protein Is Associated With Leprosy Susceptibility and Cutaneous Expression of Interleukin 1 Receptor Antagonist.
26521731 2015 Arthritic and non-arthritic synovial fluids modulate IL10 and IL1RA gene expression in differentially activated primary human monocytes.
26502861 2015 A novel association between IL1-Ra (receptor antagonist) gene polymorphism and T1DM in Al-Madina Al-Mounawra.
26487586 2016 Comprehensive serum cytokine analysis identifies IL-1RA and soluble IL-2R? as predictors of event-free survival in T-cell lymphoma.
26474296 2015 Interleukin-1 Receptor Antagonist Has a Novel Function in the Regulation of Matrix Metalloproteinase-13 Expression.
More...