Property Summary

NCBI Gene PubMed Count 120
PubMed Score 1255.16
PubTator Score 550.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
adult high grade glioma -2.000 1.2e-03
astrocytic glioma -1.600 1.8e-03
Astrocytoma, Pilocytic -1.800 6.4e-05
atypical teratoid / rhabdoid tumor -2.000 3.0e-04
colon cancer -1.100 7.9e-03
ependymoma -1.800 2.8e-03
glioblastoma -2.200 9.1e-11
group 3 medulloblastoma -1.900 8.1e-03
lung cancer -1.600 2.9e-04
lung carcinoma 1.300 1.3e-17
medulloblastoma, large-cell -1.900 1.2e-02
oligodendroglioma -1.900 8.3e-04
osteosarcoma -1.756 2.5e-02
ovarian cancer -2.400 1.9e-17
pituitary cancer -1.700 4.8e-03
primitive neuroectodermal tumor -2.400 1.5e-03
psoriasis 2.600 2.4e-19
subependymal giant cell astrocytoma -1.289 1.7e-02

Gene RIF (85)

AA Sequence

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA      1 - 70
AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS     71 - 140
YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL                                      141 - 176
//

Text Mined References (121)

PMID Year Title