Property Summary

NCBI Gene PubMed Count 115
Grant Count 92
R01 Count 72
Funding $8,286,450
PubMed Score 1222.02
PubTator Score 550.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
astrocytic glioma -1.600 0.002
posterior fossa group A ependymoma -3.400 0.000
oligodendroglioma -1.900 0.001
osteosarcoma -1.756 0.025
glioblastoma -3.100 0.000
atypical teratoid / rhabdoid tumor -2.100 0.012
medulloblastoma, large-cell -2.000 0.045
primitive neuroectodermal tumor -2.700 0.009
colon cancer -1.100 0.008
lung cancer -1.600 0.000
adult high grade glioma -2.900 0.001
group 3 medulloblastoma -1.900 0.008
pilocytic astrocytoma -2.300 0.001
subependymal giant cell astrocytoma -1.289 0.017
lung carcinoma 1.300 0.000
ovarian cancer -2.400 0.000
pituitary cancer -1.700 0.005
psoriasis 2.600 0.000

Synonym

Accession P18509 B2R7N4 Q52LQ0 PACAP
Symbols PACAP

Gene

PDB

2JOD   1GEA   2D2P  

 GWAS Trait (1)

Gene RIF (80)

PMID Text
26552048 Hypermethylation of ADCYAP1 gene may be highly associated with the development of cervical cancer.
26296898 PACAP is involved in the pathogenesis of migraine rather than tension-type headache
26275482 This review provides an overview of current knowledge regarding the neuroprotective effects, mechanisms of action, and therapeutic potential of PACAP in response to ischemic brain injuries
25599520 Deficits in PACAP were associated with clinical severity in the mild cognitive impairment and dementia stages of Alzheimer's disease.
25523790 PACAP38-PAC1 signaling process initiates bone marrow-derived cells homing into the ischemic brain for reducing brain injury.
25515530 PACAP released from retinal neural cells (photoreceptors or optic nerve cells) may regulate Sema4A expression in retinal pigment epithelial cells and thereby contribute to the maintenance of retinal structure and function.
25451228 PACAP as a negative regulator of CLU
25017241 PACAP level in cerebrospinal fluid and plasma of patients with severe traumatic brain injury
24740430 Results suggest that PACAP could protect SH-SY5Y dopaminergic cells against toxicity induced by inflammatory mediators.
24719484 The close relationship between PACAP reduction and the severity of AD pathology suggests that downregulation of PACAP may contribute to AD pathogenesis.
More...

AA Sequence

MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPLPDFDGSEPPGAGSPASAPRA      1 - 70
AAAWYRPAGRRDVAHGILNEAYRKVLDQLSAGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDS     71 - 140
YSRYRKQMAVKKYLAAVLGKRYKQRVKNKGRRIAYL                                      141 - 176
//

Text Mined References (116)

PMID Year Title
26552048 2016 Methylation of Cervical Neoplastic Cells Infected With Human Papillomavirus 16.
26296898 2015 Interictal plasma pituitary adenylate cyclase-activating polypeptide levels are decreased in migraineurs but remain unchanged in patients with tension-type headache.
26275482 2015 PACAP as a neuroprotective factor in ischemic neuronal injuries.
25599520 2015 Association of pituitary adenylate cyclase-activating polypeptide with cognitive decline in mild cognitive impairment due to Alzheimer disease.
25523790 2015 PACAP38/PAC1 signaling induces bone marrow-derived cells homing to ischemic brain.
25515530 2015 Up-regulation of semaphorin 4A expression in human retinal pigment epithelial cells by PACAP released from cocultured neural cells.
25451228 2014 PACAP inhibits tumor growth and interferes with clusterin in cervical carcinomas.
25378659 2015 Genetic loci associated with circulating levels of very long-chain saturated fatty acids.
25017241 2014 Changes of PACAP level in cerebrospinal fluid and plasma of patients with severe traumatic brain injury.
24740430 2014 PACAP protects against inflammatory-mediated toxicity in dopaminergic SH-SY5Y cells: implication for Parkinson's disease.
More...