Property Summary

Ligand Count 97
NCBI Gene PubMed Count 129
PubMed Score 83.05
PubTator Score 149.17

Knowledge Summary

Patent (1,880)

TINX Plot

  Disease (9)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.6
Liver cancer 604 0.0 0.5
Disease Target Count Z-score Confidence
substance-related disorder 162 0.0 0.9
Disease Target Count Z-score Confidence
Generalized epilepsy with febrile seizures plus 7 0.0 5.0
Disease Target Count Z-score Confidence
Alcohol dependence 107 3.277 1.6
Cataract 297 3.017 1.5

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -5.600 6.7e-08
astrocytic glioma -3.500 1.2e-03
Astrocytoma, Pilocytic -6.700 1.3e-16
atypical teratoid / rhabdoid tumor -7.300 2.2e-16
ependymoma -4.400 1.8e-02
glioblastoma -5.400 5.1e-10
lung carcinoma 2.600 2.0e-10
medulloblastoma -2.200 4.8e-03
medulloblastoma, large-cell -3.100 8.7e-04
oligodendroglioma -1.700 2.9e-02
Pick disease -2.000 4.5e-02
primitive neuroectodermal tumor -4.700 1.0e-04
subependymal giant cell astrocytoma -4.723 1.3e-02

Protein-protein Interaction (11)

Gene RIF (123)

AA Sequence

MSSPNIWSTGSSVYSTPVFSQKMTVWILLLLSLYPGFTSQKSDDDYEDYASNKTWVLTPKVPEGDVTVIL      1 - 70
NNLLEGYDNKLRPDIGVKPTLIHTDMYVNSIGPVNAINMEYTIDIFFAQTWYDRRLKFNSTIKVLRLNSN     71 - 140
MVGKIWIPDTFFRNSKKADAHWITTPNRMLRIWNDGRVLYTLRLTIDAECQLQLHNFPMDEHSCPLEFSS    141 - 210
YGYPREEIVYQWKRSSVEVGDTRSWRLYQFSFVGLRNTTEVVKTTSGDYVVMSVYFDLSRRMGYFTIQTY    211 - 280
IPCTLIVVLSWVSFWINKDAVPARTSLGITTVLTMTTLSTIARKSLPKVSYVTAMDLFVSVCFIFVFSAL    281 - 350
VEYGTLHYFVSNRKPSKDKDKKKKNPAPTIDIRPRSATIQMNNATHLQERDEEYGYECLDGKDCASFFCC    351 - 420
FEDCRTGAWRHGRIHIRIAKMDSYARIFFPTAFCLFNLVYWVSYLYL                           421 - 467
//

Text Mined References (134)

PMID Year Title