Property Summary

NCBI Gene PubMed Count 49
Grant Count 1
Funding $16,341.71
PubMed Score 21.49
PubTator Score 21.29

Knowledge Summary

Patent (1,424)

Expression

  Differential Expression (14)

Disease log2 FC p
astrocytoma -1.300 0.000
glioblastoma -4.800 0.000
oligodendroglioma -1.400 0.000
posterior fossa group A ependymoma -4.700 0.000
group 4 medulloblastoma -3.700 0.000
atypical teratoid / rhabdoid tumor -4.900 0.000
medulloblastoma, large-cell -5.100 0.000
primitive neuroectodermal tumor -3.100 0.008
pediatric high grade glioma -4.100 0.000
pilocytic astrocytoma -2.800 0.000
lung carcinoma 2.300 0.000
progressive supranuclear palsy 1.100 0.005
ovarian cancer -1.300 0.000
pituitary cancer -2.800 0.000

Synonym

Accession P18505 B2R6U7 D6REL3 Q16166 Q8TBK3
Symbols EIEE45

Gene

 Grant Application (1)

  TechDev Info (1)

Susumu Tomita Biochemical interactoin

 GWAS Trait (1)

Gene RIF (27)

PMID Text
25660468 This study showed that in male group the expression of GABRB1 was generally lower in schizophrenia cases compared to the control, but was higher in female group.
25566775 PCDHB14- and GABRB1-like nervous system developmental genes are altered during early neuronal differentiation of NCCIT cells treated with ethanol
25241062 Both mRNA and protein of GABAB receptor subunits, GABAB1 and GABAB2, were co-expressed in cultured human RPE cells; GABAB receptors regulate the [Ca2+]i via a pertussis toxin-sensitive Gi/o-protein pathway and a phospholipase C pathway
25192656 study provides the first evidence for the involvement of the GABRB1 gene in the thalamus structure and their interactive effects on intelligence
24022508 GABRB1 protein levels were significantly decreased in schizophrenia, major depressive disorder, and bipolar disorder patients' lateral cerebellum compared to controls.
23917429 This study demonstrates altered patterns of N-glycosylation of GABRB1 in the temporal lobe in schizophrenia.
23392927 These results suggest that epigenetic control of gene expression may affect the expression of GABRB1 and disrupt inhibitory synaptic transmission during embryonic development.
22393585 In cases of tramadol-induced death, the expression of GABA(A)alpha1 and GABA(B)1 significantly increased in the medulla oblongata solitary nucleus and ambiguous nucleus.
21751815 Data indicate the selectivity of some selected compounds were assessed in recombinant alpha(1)beta(2)gamma(2)L, alpha(2)beta(1)gamma(2)L, and alpha(5)beta(2)gamma(2)L GABA(A) receptors.
20848605 Gaba-A receptor subunit beta1 is not involved in amygdala hyperexcitability of patients with temporal lobe epilepsy.
More...

AA Sequence

MWTVQNRESLGLLSFPVMITMVCCAHSTNEPSNMSYVKETVDRLLKGYDIRLRPDFGGPPVDVGMRIDVA      1 - 70
SIDMVSEVNMDYTLTMYFQQSWKDKRLSYSGIPLNLTLDNRVADQLWVPDTYFLNDKKSFVHGVTVKNRM     71 - 140
IRLHPDGTVLYGLRITTTAACMMDLRRYPLDEQNCTLEIESYGYTTDDIEFYWNGGEGAVTGVNKIELPQ    141 - 210
FSIVDYKMVSKKVEFTTGAYPRLSLSFRLKRNIGYFILQTYMPSTLITILSWVSFWINYDASAARVALGI    211 - 280
TTVLTMTTISTHLRETLPKIPYVKAIDIYLMGCFVFVFLALLEYAFVNYIFFGKGPQKKGASKQDQSANE    281 - 350
KNKLEMNKVQVDAHGNILLSTLEIRNETSGSEVLTSVSDPKATMYSYDSASIQYRKPLSSREAYGRALDR    351 - 420
HGVPSKGRIRRRASQLKVKIPDLTDVNSIDKWSRMFFPITFSLFNVVYWLYYVH                    421 - 474
//

Text Mined References (50)

PMID Year Title
26950270 2016 Epileptic encephalopathy de novo GABRB mutations impair GABAA receptor function.
25660468 2015 Sex differences in GABAergic gene expression occur in the anterior cingulate cortex in schizophrenia.
25566775 2015 PCDHB14- and GABRB1-like nervous system developmental genes are altered during early neuronal differentiation of NCCIT cells treated with ethanol.
25241062 2014 GABAB1 and GABAB2 receptor subunits co-expressed in cultured human RPE cells regulate intracellular Ca2+ via Gi/o-protein and phospholipase C pathways.
25192656 2014 The GABRB1 gene is associated with thalamus volume and modulates the association between thalamus volume and intelligence.
24722188 2014 Protein interaction network of alternatively spliced isoforms from brain links genetic risk factors for autism.
24022508 2013 Expression of GABAA ?2-, ?1- and ?-receptors are altered significantly in the lateral cerebellum of subjects with schizophrenia, major depression and bipolar disorder.
23917429 2014 N-Glycosylation of GABAA receptor subunits is altered in Schizophrenia.
23392927 2013 The effect of folic acid on GABA(A)-B 1 receptor subunit.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
More...