Tbio | HLA class I histocompatibility antigen, B-37 alpha chain |
Involved in the presentation of foreign antigens to the immune system.
HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq, Jul 2008]
HLA-B belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. Class I molecules play a central role in the immune system by presenting peptides derived from the endoplasmic reticulum lumen. They are expressed in nearly all cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon 1 encodes the leader peptide, exon 2 and 3 encode the alpha1 and alpha2 domains, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region and exons 6 and 7 encode the cytoplasmic tail. Polymorphisms within exon 2 and exon 3 are responsible for the peptide binding specificity of each class one molecule. Typing for these polymorphisms is routinely done for bone marrow and kidney transplantation. Hundreds of HLA-B alleles have been described. [provided by RefSeq, Jul 2008]
Comments
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Behcet's disease | 89 | 5.55 | 2.8 |
Ankylosing spondylitis | 140 | 5.118 | 2.6 |
Psoriatic arthritis | 86 | 3.615 | 1.8 |
Herpes zoster | 68 | 0.0 | 5.0 |
Juvenile rheumatoid arthritis | 111 | 0.0 | 5.0 |
Rheumatoid arthritis | 1191 | 0.0 | 5.0 |
Disease | Target Count | Z-score | Confidence |
---|---|---|---|
Congenital adrenal hyperplasia | 73 | 4.559 | 2.3 |
Uveitis | 103 | 4.228 | 2.1 |
psoriasis | 6694 | 4.175 | 2.1 |
Hypersensitivity reaction type II disease | 253 | 3.924 | 2.0 |
Acquired immunodeficiency syndrome | 197 | 3.883 | 1.9 |
Cancer | 2499 | 3.751 | 1.9 |
Arthritis | 290 | 3.576 | 1.8 |
diabetes mellitus | 1728 | 3.285 | 1.6 |
Retinal vasculitis | 36 | 3.113 | 1.6 |
MRVTAPRTLLLLLWGAVALTETWAGSHSMRYFHTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRTE 1 - 70 PRAPWIEQEGPEYWDRETQISKTNTQTYREDLRTLLRYYNQSEAGSHTIQRMSGCDVGPDGRLLRGYNQF 71 - 140 AYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQDRAYLEGTCVEWLRRYLENGKETLQRADPPK 141 - 210 THVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQR 211 - 280 YTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVATVMCRRKSSGGKGGSYSQAASS 281 - 350 DSAQGSDVSLTA 351 - 362 //