Property Summary

NCBI Gene PubMed Count 222
Grant Count 98
R01 Count 47
Funding $14,702,727.97
PubMed Score 227.38
PubTator Score 363.10

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18440 A8K4E7 O15159 O15300 Q546N1 Q96TE9
Symbols AAC1
MNAT
NATI
NAT-1

Gene

PANTHER Protein Class (2)

PDB

2DSS   2GWU   2IJA   2PQT  

 IMPC Term (1)

Gene RIF (228)

PMID Text
26409796 The rs1799931(G>A) genotype was detected in the control population but not in the T2DM population. The wild type (G) allele frequency was higher in T2DM than controls. The mutant allele (A) in rs1799931(G>A) had a protective effect for T2DM.
25886288 NAT1 genetic polymorphisms were found to be a risk factor for smokers in the Black population of South Africa with esophageal squamous cell carcinoma.
25834322 NAT1 genotype affects thioguanine nucleotide levels in patients treated with thiopurines and aminosalicylates and could therefore influence the toxicity and efficacy of these drugs.
25528056 We report that miR-1290 directly targets the NAT1 3'-UTR and that NAT1 protein expression is correlated with improved OS of breast cancer patients.
25413361 Arylamine N-acetyltransferase polymorphisms in Han Chinese patients with ankylosing spondylitis and their correlation to the adverse drug reactions to sulfasalazine
25156213 NAT1 has a role in the metabolic pathway of nicotine/cotinine and/or their metabolites.
24656773 Candidate gene NAT1 were elevated in male breast cancer biopsies compared to those from female patients without regard to Estrogen Receptors status.
23772068 Complementation studies revealed that the N-terminal domain of L9 is necessary and sufficient to improve the fitness of some Der mutants, suggesting that this domain may help stabilize compromised ribosomes that accumulate when Der is defective.
23660777 the present study provides evidence for the role of NAT1 and NAT2 variations in NSCLP, and indicates that interactions between the NAT1 and NAT2 genes may be important in susceptibility to NSCLP.
23569127 This meta-analysis suggests that there was no association between the NAT1*10 allele and bladder cancer risk.
More...

AA Sequence

MDIEAYLERIGYKKSRNKLDLETLTDILQHQIRAVPFENLNIHCGDAMDLGLEAIFDQVVRRNRGGWCLQ      1 - 70
VNHLLYWALTTIGFETTMLGGYVYSTPAKKYSTGMIHLLLQVTIDGRNYIVDAGFGRSYQMWQPLELISG     71 - 140
KDQPQVPCVFRLTEENGFWYLDQIRREQYIPNEEFLHSDLLEDSKYRKIYSFTLKPRTIEDFESMNTYLQ    141 - 210
TSPSSVFTSKSFCSLQTPDGVHCLVGFTLTHRRFNYKDNTDLIEFKTLSEEEIEKVLKNIFNISLQRKLV    211 - 280
PKHGDRFFTI                                                                281 - 290
//

Text Mined References (225)

PMID Year Title
26409796 N-acetyltransferase 1 and 2 polymorphisms and risk of diabetes mellitus type 2 in a Saudi population.
25886288 2015 NAT1 and NAT2 genetic polymorphisms and environmental exposure as risk factors for oesophageal squamous cell carcinoma: a case-control study.
25834322 2015 Thiopurine metabolites variations during co-treatment with aminosalicylates for inflammatory bowel disease: effect of N-acetyl transferase polymorphisms.
25528056 2014 Immunohistochemical determination of the miR-1290 target arylamine N-acetyltransferase 1 (NAT1) as a prognostic biomarker in breast cancer.
25413361 2014 Arylamine N-acetyltransferase polymorphisms in Han Chinese patients with ankylosing spondylitis and their correlation to the adverse drug reactions to sulfasalazine.
25156213 2015 N-acetyltransferase 1 polymorphism increases cotinine levels in Caucasian children exposed to secondhand smoke: the CCAAPS birth cohort.
24656773 2014 Gender-associated expression of tumor markers and a small gene set in breast carcinoma.
23772068 2013 Crippling the essential GTPase Der causes dependence on ribosomal protein L9.
23660777 2013 Association of NAT1 and NAT2 genes with nonsyndromic cleft lip and palate.
23569127 2013 N-acetyltransferase 1 polymorphism and bladder cancer susceptibility: a meta-analysis of epidemiological studies.
More...