Property Summary

Ligand Count 13
NCBI Gene PubMed Count 79
PubMed Score 70.12
PubTator Score 128.10

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
Myocardial Ischemia 169 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count P-value
osteosarcoma 7950 9.2e-06
psoriasis 6694 9.1e-05
ovarian cancer 8520 2.5e-04
oligodendroglioma 2850 5.8e-04
group 3 medulloblastoma 4104 1.0e-03
ependymoma 4679 2.4e-03
colon cancer 1478 3.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8

Expression

  Differential Expression (7)

Disease log2 FC p
colon cancer -1.900 3.1e-02
ependymoma 1.500 2.4e-03
group 3 medulloblastoma -1.600 1.0e-03
oligodendroglioma 1.800 5.8e-04
osteosarcoma -1.870 9.2e-06
ovarian cancer 1.700 2.5e-04
psoriasis -2.400 9.1e-05

 CSPA Cell Line (1)

Protein-protein Interaction (8)

Gene RIF (39)

AA Sequence

MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNIT      1 - 70
LGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDE     71 - 140
TPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSKQAGSHSNSFRLSNGRTEDVEPQSVPLLAR    141 - 210
SPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHS    211 - 280
RVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKC    281 - 350
AQYWPDQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM    351 - 420
LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDMQ    421 - 490
YVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMK    491 - 560
KNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIV    561 - 630
MLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEV    631 - 700
GIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQ    701 - 770
RPHMVQTLEQYEFCYKVVQEYIDAFSDYANFK                                          771 - 802
//

Text Mined References (87)

PMID Year Title