Property Summary

NCBI Gene PubMed Count 77
Grant Count 54
R01 Count 43
Funding $3,956,915.32
PubMed Score 68.94
PubTator Score 128.10

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.500 0.002
oligodendroglioma 1.800 0.001
psoriasis -2.400 0.000
osteosarcoma -1.870 0.000
colon cancer -1.900 0.031
group 3 medulloblastoma -1.600 0.001
ovarian cancer 1.700 0.000

Synonym

Accession P18433 A8K2G8 D3DVX5 Q14513 Q7Z2I2 Q96TD9 Protein-tyrosine phosphatase alpha
Symbols LRP
HLPR
PTPA
HEPTP
HPTPA
RPTPA
PTPRL2
HPTPalpha
R-PTP-alpha

Gene

Gene RIF (38)

PMID Text
25694432 Data indicate that scaffold protein RACK1 plays a role in IGF-1-mediated protein-tyrosine phosphatase alpha (PTPalpha) tyrosine phosphorylation in MCF-7 Cells.
25631816 A receptor type-protein tyrosine phosphatase alpha-Src family kinase-Rap1 pathway was identified as responsible for recruiting myosin IIB to the zonula adherens in epithelial cells and supporting contractile tension.
25393624 no evidence was seen for the association of rare, missense mutations in the PTPRA gene with schizophrenia or autism spectrum disorders
24652832 recruited to epithelial adherens junctions for cadherin-dependent cell adhesion and tissue architecture formation
24217252 new role for PTPalpha in the regulation of motility of mammary epithelial cells in response to ErbB2 activation.
23532252 results suggest that PTPalpha links activation of epidermal growth factor receptor (EGFR) signaling with Src activation and may provide a novel therapeutic target for treatment of breast cancer.
23487342 A single-nucleotide polymorphism (rs6138953) on the PTPRA gene in the 20p13 region was found to be associated with elevated fasting glucose level.
23318421 Results suggest that inhibition of PTPalpha can have a beneficial effect on HER2-positive breast cancers, but that inhibition of additional targets is needed to block breast tumorigenesis.
23029023 our results suggest that plasma PTPalpha and fibronectin may be associated with opisthorchiasis.
22647903 The extracellular proteolytic processing is a novel mechanism for PTPalpha regulation.
More...

AA Sequence

MDSWFILVLLGSGLICVSANNATTVAPSVGITRLINSSTAEPVKEEAKTSNPTSSLTSLSVAPTFSPNIT      1 - 70
LGPTYLTTVNSSDSDNGTTRTASTNSIGITISPNGTWLPDNQFTDARTEPWEGNSSTAATTPETFPPSDE     71 - 140
TPIIAVMVALSSLLVIVFIIIVLYMLRFKKYKQAGSHSNSKQAGSHSNSFRLSNGRTEDVEPQSVPLLAR    141 - 210
SPSTNRKYPPLPVDKLEEEINRRMADDNKLFREEFNALPACPIQATCEAASKEENKEKNRYVNILPYDHS    211 - 280
RVHLTPVEGVPDSDYINASFINGYQEKNKFIAAQGPKEETVNDFWRMIWEQNTATIVMVTNLKERKECKC    281 - 350
AQYWPDQGCWTYGNIRVSVEDVTVLVDYTVRKFCIQQVGDMTNRKPQRLITQFHFTSWPDFGVPFTPIGM    351 - 420
LKFLKKVKACNPQYAGAIVVHCSAGVGRTGTFVVIDAMLDMMHTERKVDVYGFVSRIRAQRCQMVQTDMQ    421 - 490
YVFIYQALLEHYLYGDTELEVTSLETHLQKIYNKIPGTSNNGLEEEFKKLTSIKIQNDKMRTGNLPANMK    491 - 560
KNRVLQIIPYEFNRVIIPVKRGEENTDYVNASFIDGYRQKDSYIASQGPLLHTIEDFWRMIWEWKSCSIV    561 - 630
MLTELEERGQEKCAQYWPSDGLVSYGDITVELKKEEECESYTVRDLLVTNTRENKSRQIRQFHFHGWPEV    631 - 700
GIPSDGKGMISIIAAVQKQQQQSGNHPITVHCSAGAGRTGTFCALSTVLERVKAEGILDVFQTVKSLRLQ    701 - 770
RPHMVQTLEQYEFCYKVVQEYIDAFSDYANFK                                          771 - 802
//

Text Mined References (85)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25694432 2015 The interaction of protein-tyrosine phosphatase ? (PTP?) and RACK1 protein enables insulin-like growth factor 1 (IGF-1)-stimulated Abl-dependent and -independent tyrosine phosphorylation of PTP?.
25631816 2015 An RPTP?/Src family kinase/Rap1 signaling module recruits myosin IIB to support contractile tension at apical E-cadherin junctions.
25393624 2014 Resequencing and association analysis of PTPRA, a possible susceptibility gene for schizophrenia and autism spectrum disorders.
24652832 2014 RPTP? controls epithelial adherens junctions, linking E-cadherin engagement to c-Src-mediated phosphorylation of cortactin.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24217252 2013 Receptor protein-tyrosine phosphatase ? regulates focal adhesion kinase phosphorylation and ErbB2 oncoprotein-mediated mammary epithelial cell motility.
24189400 2013 Perturbation of the mutated EGFR interactome identifies vulnerabilities and resistance mechanisms.
23532252 2013 PTP?-mediated Src activation by EGF in human breast cancer cells.
23487342 2013 Combined genome-wide linkage and association analyses of fasting glucose level in healthy twins and families of Korea.
More...