Property Summary

NCBI Gene PubMed Count 106
PubMed Score 357.15
PubTator Score 789.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
adult high grade glioma 1.100 2.2e-03
atypical teratoid / rhabdoid tumor 1.100 8.0e-03
facioscapulohumeral dystrophy -2.300 2.1e-03
medulloblastoma, large-cell 1.400 2.0e-05
osteosarcoma -2.854 2.8e-06
pancreatic ductal adenocarcinoma liver m... -4.306 5.5e-04
psoriasis 2.500 1.5e-19

Gene RIF (78)

AA Sequence

MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPH      1 - 70
VGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISV     71 - 140
NLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQ    141 - 210
PYLQTLPVTTEIDSFADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFA    211 - 280
ISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLN    281 - 350
FSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN    351 - 420
AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMRV             421 - 481
//

Text Mined References (111)

PMID Year Title