Property Summary

NCBI Gene PubMed Count 102
Grant Count 68
R01 Count 27
Funding $7,164,547.14
PubMed Score 341.49
PubTator Score 789.05

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Synonym

Accession P18428 B2R938 O43438 Q92672 Q9H403 Q9UD66 LBP
Symbols BPIFD2

Gene

LBP

Gene RIF (75)

PMID Text
26804480 LBP serves not only as an extracellular LPS shuttle but in addition facilitates intracellular transport of LPS.
26799617 Serum LBP level is significantly elevated in polycystic ovary syndrome women and is associated with insulin resistance.
26046926 LBP level was not significantly different in neutropenic systemic inflammatory response syndrome patients and sepsis patients.
25978344 Report increased secretion of Fetuin A, LBP and HMGB-1 from subcutaneous adipose tissue in metabolic syndrome.
25785448 Low levels of microbial translocation marker LBP are associated with sustained viral response after anti-HCV treatment in HIV-1/HCV co-infected patients
25613713 The main findings of this study are that, in acute stroke patients, levels of LBP, IL-10, IL-6 and CRP show a different time course in patients with and without post-stroke infection.
25063948 Adjusting for body mass index and waist circumference, LBP levels remained significantly increased in metabolic syndrome and increased with increasing numbers of MetS risk factors.
25014514 serum level elevated in late-onset neonatal sepsis in very low birth weight infants
24906952 study suggested that elevated plasma LBP was associated with an increased risk of developing MetS among middle-aged and older Chinese, especially in normal-weight individuals.
24667918 Microarray analysis indicates HIV-1 Tat-induced upregulation of lipopolysaccharide binding protein (LBP) in primary human brain microvascular endothelial cells
More...

AA Sequence

MGALARALPSILLALLLTSTPEALGANPGLVARITDKGLQYAAQEGLLALQSELLRITLPDFTGDLRIPH      1 - 70
VGRGRYEFHSLNIHSCELLHSALRPVPGQGLSLSISDSSIRVQGRWKVRKSFFKLQGSFDVSVKGISISV     71 - 140
NLLLGSESSGRPTVTASSCSSDIADVEVDMSGDLGWLLNLFHNQIESKFQKVLESRICEMIQKSVSSDLQ    141 - 210
PYLQTLPVTTEIDSFADIDYSLVEAPRATAQMLEVMFKGEIFHRNHRSPVTLLAAVMSLPEEHNKMVYFA    211 - 280
ISDYVFNTASLVYHEEGYLNFSITDDMIPPDSNIRLTTKSFRPFVPRLARLYPNMNLELQGSVPSAPLLN    281 - 350
FSPGNLSVDPYMEIDAFVLLPSSSKEPVFRLSVATNVSATLTFNTSKITGFLKPGKVKVELKESKVGLFN    351 - 420
AELLEALLNYYILNTFYPKFNDKLAEGFPLPLLKRVQLYDLGLQIHKDFLFLGANVQYMRV             421 - 481
//

Text Mined References (107)

PMID Year Title
26804480 2016 Lipopolysaccharide-binding protein is bound and internalized by host cells and colocalizes with LPS in the cytoplasm: Implications for a role of LBP in intracellular LPS-signaling.
26799617 2016 Serum LBP Is Associated with Insulin Resistance in Women with PCOS.
26046926 2015 Sepsis biomarkers in neutropaenic systemic inflammatory response syndrome patients on standard care wards.
25978344 2015 Increased adipose tissue secretion of Fetuin-A, lipopolysaccharide-binding protein and high-mobility group box protein 1 in metabolic syndrome.
25785448 2015 Low levels of microbial translocation marker LBP are associated with sustained viral response after anti-HCV treatment in HIV-1/HCV co-infected patients.
25613713 2015 Lipopolysaccharide binding protein, interleukin-10, interleukin-6 and C-reactive protein blood levels in acute ischemic stroke patients with post-stroke infection.
25063948 2014 Circulating pathogen-associated molecular pattern - binding proteins and High Mobility Group Box protein 1 in nascent metabolic syndrome: implications for cellular Toll-like receptor activity.
25014514 2015 The value of lipopolysaccharide binding protein for diagnosis of late-onset neonatal sepsis in very low birth weight infants.
24906952 2014 Lipopolysaccharide binding protein, obesity status and incidence of metabolic syndrome: a prospective study among middle-aged and older Chinese.
24335151 2014 Lipopolysaccharide-binding protein as marker of fetal inflammatory response syndrome after preterm premature rupture of membranes.
More...