Property Summary

Ligand Count 327
NCBI Gene PubMed Count 92
PubMed Score 90.66
PubTator Score 1570.70

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (25)

Disease log2 FC p
adrenocortical carcinoma 1.763 2.8e-04
adult high grade glioma -3.100 6.0e-05
astrocytic glioma -3.300 1.6e-03
Astrocytoma, Pilocytic -3.800 3.4e-11
atypical teratoid / rhabdoid tumor -2.800 3.9e-06
colon cancer 1.300 3.5e-02
ductal carcinoma in situ 2.300 7.8e-04
ependymoma -3.500 3.2e-03
esophageal adenocarcinoma -1.400 4.0e-02
glioblastoma -2.800 1.6e-08
intraductal papillary-mucinous adenoma (... 1.400 9.7e-03
intraductal papillary-mucinous carcinoma... 1.200 1.8e-02
intraductal papillary-mucinous neoplasm ... 2.500 2.9e-03
invasive ductal carcinoma 2.800 7.0e-03
lung adenocarcinoma 1.896 3.9e-07
lung cancer 1.200 1.8e-02
lung carcinoma 1.400 2.0e-24
medulloblastoma, large-cell -1.200 4.5e-03
non-small cell lung cancer 2.731 8.7e-25
oligodendroglioma -3.000 4.2e-03
ovarian cancer 1.100 3.1e-02
pancreatic cancer 1.100 2.5e-04
Parkinson's disease -1.200 4.6e-02
Pick disease -1.500 1.9e-03
tuberculosis 1.700 3.0e-07

 GWAS Trait (1)

Protein-protein Interaction (1)

Gene RIF (75)

AA Sequence

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQ      1 - 70
YASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAV     71 - 140
YADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA    141 - 210
LASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF                         211 - 259
//

Text Mined References (94)

PMID Year Title