Property Summary

NCBI Gene PubMed Count 87
Grant Count 8
R01 Count 6
Funding $687,844
PubMed Score 82.05
PubTator Score 1570.70

Knowledge Summary

Patent

No data available

Expression

 GWAS Trait (1)

Gene RIF (70)

PMID Text
26174685 the genotypic distribution of 22 single nucleotide polymorphisms in SRD5A1 and SRD5A2 in a set of Spanish prostate cancer patients, were evaluated.
25960412 A total of 2 SNPs in SRD5A1-rs3822430 and rs1691053-were associated with prostate-specific antigen level at diagnosis.
25850410 study found SRD5A enzyme is present in spermatozoa and that its cellular content is lowered in sperm samples from varicocele patients compared to healthy subjects
25475427 Results show that 5alpha-reductase type 1 was associated with intratumoral dihydrotestosterone concentrations and is an independent prognostic factor in endometrioid endometrial adenocarcinoma.
25463305 In model cell lines of endometrial cancer, AKR1C2 and SRD5A1 have crucial roles in progesterone metabolism.
24986533 Increased 5alphaR activity and glucocorticoid secretion rate over time are linked with the development of metabolic disease, and may represent targets for therapeutic intervention.
24277450 SRD5A1 rs166050C risk variant was associated with greater prostatic exposure to androsterone
24244276 Significantly higher levels of SRD5A1, AKR1C2, AKR1C3, and HSD17B10 mRNA were however found in bone metastases than in non-malignant and/or malignant prostate tissue
23499746 SRD5A1 and SRD5A2 single nucleotide polymorphisms are significantly associated with the clinical characteristics of benign prostatic hyperplasia and the efficacy of benign prostatic hyperplasia treatment.
23183084 Different effects were seen for progesterone, which significantly decreased SRD5A1 protein levels.
More...

AA Sequence

MATATGVAEERLLAALAYLQCAVGCAVFARNRQTNSVYGRHALPSHRLRVPARAAWVVQELPSLALPLYQ      1 - 70
YASESAPRLRSAPNCILLAMFLVHYGHRCLIYPFLMRGGKPMPLLACTMAIMFCTCNGYLQSRYLSHCAV     71 - 140
YADDWVTDPRFLIGFGLWLTGMLINIHSDHILRNLRKPGDTGYKIPRGGLFEYVTAANYFGEIMEWCGYA    141 - 210
LASWSVQGAAFAFFTFCFLSGRAKEHHEWYLRKFEEYPKFRKIIIPFLF                         211 - 259
//

Text Mined References (89)

PMID Year Title
26174685 2015 Intraethnic variation in steroid-5-alpha-reductase polymorphismsin prostate cancer patients: a potential factor implicated in 5-alpha-reductase inhibitor treatment.
25960412 2015 Genetic variations in genes involved in testosterone metabolism are associated with prostate cancer progression: A Spanish multicenter study.
25850410 2015 Human sperm molecular anatomy: the enzyme 5?-reductase (SRD5A) is present in the sperm and may be involved in the varicocele-related infertility.
25475427 2015 The role of 5?-reductase type 1 associated with intratumoral dihydrotestosterone concentrations in human endometrial carcinoma.
25463305 2015 Important roles of the AKR1C2 and SRD5A1 enzymes in progesterone metabolism in endometrial cancer model cell lines.
24986533 2014 Longitudinal changes in glucocorticoid metabolism are associated with later development of adverse metabolic phenotype.
24277450 2014 Importance of 5?-reductase gene polymorphisms on circulating and intraprostatic androgens in prostate cancer.
24244276 2013 Characterization of prostate cancer bone metastases according to expression levels of steroidogenic enzymes and androgen receptor splice variants.
23499746 2013 SRD5A1 and SRD5A2 are associated with treatment for benign prostatic hyperplasia with the combination of 5?-reductase inhibitors and ?-adrenergic receptor antagonists.
23183084 2013 Progestin effects on expression of AKR1C1-AKR1C3, SRD5A1 and PGR in the Z-12 endometriotic epithelial cell line.
More...