Property Summary

NCBI Gene PubMed Count 142
Grant Count 293
R01 Count 158
Funding $43,578,183.99
PubMed Score 1981.88
PubTator Score 1025.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
astrocytoma 1.500 0.024
glioblastoma 1.400 0.036
atypical teratoid/rhabdoid tumor 2.000 0.000
tuberculosis 1.600 0.000
pancreatic ductal adenocarcinoma liver m... 1.051 0.039
colon cancer -3.700 0.000
lung cancer -1.100 0.001
diabetes mellitus -1.200 0.005
group 4 medulloblastoma -1.500 0.000
posterior fossa group A ependymoma 1.100 0.000
subependymal giant cell astrocytoma 1.337 0.020
lung carcinoma -1.600 0.000
ovarian cancer 2.100 0.000
axial spondyloarthropathy 1.100 0.004
pancreatic cancer 1.100 0.006

Synonym

Accession P18206 Q16450 Q5SWX2 Q7Z3B8 Q8IXU7
Symbols MV
MVCL
CMD1W
CMH15
HEL114

Gene

VCL

PDB

1SYQ   4DJ9   4LN2   4LNP   1YDI   4EHP   3H2U   3H2V   3VF0   1RKC   1RKE   1TR2   2GWW   2HSQ   2IBF   3JBK   3MYI   3RF3   3S90   3TJ5   3TJ6   4PR9   5L0C   5L0D   5L0F   5L0G   5L0H   5L0I   5L0J  

Gene RIF (79)

PMID Text
26728462 roles and mechanisms of phospholipids in regulating the structure and function of vinculin and of its muscle-specific metavinculin splice variant.
26650627 Three novel genes were identified as recurrently mutated; MYCN, MYO5B and VCL, and mutations in these genes were exclusively found in malignant sympathetic paraganglioma tumors.
26493222 Upon actin engagement, the N-terminal "strap" and helix 1 are displaced from the vinculin tail helical bundle to mediate actin bundling.
26487440 The VCL-encoding protein was involved in cardiomyopathy that associated with hypertension, therefore our results suggest the rs4746172 of VCL may be a novel target for clinical interventions to reduce CVD risk by regulating blood pressure in male Chinese
26109125 This study defined a plastic relationship between vinculin-mediated tension and adhesion complex area that controls fundamental cell-matrix adhesion properties.
26053221 Data indicate that specific protein interactions are spatially segregated within focal adhesions (FAs) at the nanoscale to regulate vinculin activation and function.
25997717 Analysis showed that ITGB4 and VCL were upregulated in exosomes derived from taxane-resistant prostate cancer cells suggesting them as useful markers for progression of prostate cancer associated with taxane-resistance.
25942574 vinculin, present in the joints of anti-citrullinated protein antibody (ACPA)(+) rheumatoid arthritis patients, was identified as an autoantigen targeted by ACPA and CD4(+) T cells.
25745180 HIV-1 Nef co-localizes with vinvulin inside podosomes in human monocyte-derived macrophages
25527710 HIV-1 Nef co-localizes with vinvulin inside podosomes in human monocyte-derived macrophages
More...

AA Sequence

MPVFHTRTIESILEPVAQQISHLVIMHEEGEVDGKAIPDLTAPVAAVQAAVSNLVRVGKETVQTTEDQIL      1 - 70
KRDMPPAFIKVENACTKLVQAAQMLQSDPYSVPARDYLIDGSRGILSGTSDLLLTFDEAEVRKIIRVCKG     71 - 140
ILEYLTVAEVVETMEDLVTYTKNLGPGMTKMAKMIDERQQELTHQEHRVMLVNSMNTVKELLPVLISAMK    141 - 210
IFVTTKNSKNQGIEEALKNRNFTVEKMSAEINEIIRVLQLTSWDEDAWASKDTEAMKRALASIDSKLNQA    211 - 280
KGWLRDPSASPGDAGEQAIRQILDEAGKVGELCAGKERREILGTCKMLGQMTDQVADLRARGQGSSPVAM    281 - 350
QKAQQVSQGLDVLTAKVENAARKLEAMTNSKQSIAKKIDAAQNWLADPNGGPEGEEQIRGALAEARKIAE    351 - 420
LCDDPKERDDILRSLGEISALTSKLADLRRQGKGDSPEARALAKQVATALQNLQTKTNRAVANSRPAKAA    421 - 490
VHLEGKIEQAQRWIDNPTVDDRGVGQAAIRGLVAEGHRLANVMMGPYRQDLLAKCDRVDQLTAQLADLAA    491 - 560
RGEGESPQARALASQLQDSLKDLKARMQEAMTQEVSDVFSDTTTPIKLLAVAATAPPDAPNREEVFDERA    561 - 630
ANFENHSGKLGATAEKAAAVGTANKSTVEGIQASVKTARELTPQVVSAARILLRNPGNQAAYEHFETMKN    631 - 700
QWIDNVEKMTGLVDEAIDTKSLLDASEEAIKKDLDKCKVAMANIQPQMLVAGATSIARRANRILLVAKRE    701 - 770
VENSEDPKFREAVKAASDELSKTISPMVMDAKAVAGNISDPGLQKSFLDSGYRILGAVAKVREAFQPQEP    771 - 840
DFPPPPPDLEQLRLTDELAPPKPPLPEGEVPPPRPPPPEEKDEEFPEQKAGEVINQPMMMAARQLHDEAR    841 - 910
KWSSKPGIPAAEVGIGVVAEADAADAAGFPVPPDMEDDYEPELLLMPSNQPVNQPILAAAQSLHREATKW    911 - 980
SSKGNDIIAAAKRMALLMAEMSRLVRGGSGTKRALIQCAKDIAKASDEVTRLAKEVAKQCTDKRIRTNLL    981 - 1050
QVCERIPTISTQLKILSTVKATMLGRTNISDEESEQATEMLVHNAQNLMQSVKETVREAEAASIKIRTDA   1051 - 1120
GFTLRWVRKTPWYQ                                                           1121 - 1134
//

Text Mined References (153)

PMID Year Title
26728462 2016 Mechanisms and Functions of Vinculin Interactions with Phospholipids at Cell Adhesion Sites.
26691986 2016 Mutations in CTNNA1 cause butterfly-shaped pigment dystrophy and perturbed retinal pigment epithelium integrity.
26650627 2016 Malignant pheochromocytomas/paragangliomas harbor mutations in transport and cell adhesion genes.
26493222 2016 The Structural Basis of Actin Organization by Vinculin and Metavinculin.
26487440 2015 Sex-specific association of rs4746172 of VCL gene with hypertension in two Han populations from Southern China.
26109125 2015 A plastic relationship between vinculin-mediated tension and adhesion complex area defines adhesion size and lifetime.
26053221 2015 Molecular mechanism of vinculin activation and nanoscale spatial organization in focal adhesions.
25997717 2015 Integrin ?4 and vinculin contained in exosomes are potential markers for progression of prostate cancer associated with taxane-resistance.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25942574 2015 Crossreactivity to vinculin and microbes provides a molecular basis for HLA-based protection against rheumatoid arthritis.
More...