Property Summary

NCBI Gene PubMed Count 383
PubMed Score 2034.62
PubTator Score 1031.84

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5
Disease Target Count Z-score Confidence
Cancer 2499 5.129 2.6
Vascular disease 319 4.437 2.2

Expression

  Differential Expression (32)

Disease log2 FC p
acute myeloid leukemia 2.000 3.3e-02
adrenocortical carcinoma -2.317 1.2e-03
astrocytoma 2.900 6.3e-03
autosomal dominant Emery-Dreifuss muscul... 1.822 3.9e-02
Breast cancer -2.300 3.0e-02
breast carcinoma -2.100 6.6e-23
colon cancer -2.000 3.3e-02
Down syndrome -1.400 3.5e-03
gastric carcinoma 2.500 5.5e-03
glioblastoma 1.900 2.7e-03
group 4 medulloblastoma -2.100 9.0e-03
interstitial cystitis 1.200 1.9e-02
intraductal papillary-mucinous adenoma (... -1.600 3.5e-03
intraductal papillary-mucinous carcinoma... -1.100 2.3e-02
intraductal papillary-mucinous neoplasm ... -1.300 5.0e-02
invasive ductal carcinoma -1.800 4.9e-03
lung adenocarcinoma -1.402 6.6e-04
lung cancer -2.900 2.0e-05
lung carcinoma -2.600 9.0e-12
medulloblastoma, large-cell -2.200 2.9e-02
nephrosclerosis -1.695 1.2e-05
non primary Sjogren syndrome sicca -1.300 1.0e-02
non-small cell lung cancer -2.141 1.0e-13
oligodendroglioma -1.700 1.3e-02
ovarian cancer 2.300 1.8e-04
pancreatic cancer 1.400 3.4e-02
pituitary cancer -2.700 2.0e-04
primary pancreatic ductal adenocarcinoma 1.538 4.5e-02
psoriasis 1.200 2.0e-03
pterygium -2.100 3.9e-02
Rheumatoid arthritis 1.800 4.2e-03
ulcerative colitis 1.600 3.9e-04

Protein-protein Interaction (4)

Gene RIF (354)

AA Sequence

MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGG      1 - 70
GGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLE     71 - 140
PAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFP    141 - 210
TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESR    211 - 280
TQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFS    281 - 350
RSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR    351 - 420
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGF    421 - 490
PSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC                     491 - 543
//

Text Mined References (386)

PMID Year Title