Property Summary

NCBI Gene PubMed Count 359
Grant Count 653
R01 Count 384
Funding $70,395,110.39
PubMed Score 1948.53
PubTator Score 1031.84

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18146 EGR-1
Symbols TIS8
AT225
G0S30
NGFI-A
ZNF225
KROX-24
ZIF-268

Gene

PDB

4R2A   4R2C   4R2D   4X9J  

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
588618 other 3 / 0 / 0 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in DLD1 cells
588644 other 0 / 0 / 3 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in HCT116 human colorectal carcinoma cells
588657 other 2 / 0 / 1 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in HT29 human colorectal carcinoma cells
588665 other 1 / 0 / 2 Late stage assay provider counterscreen results from the probe development effort to identify inhibitors of kruppel-like factor 5 (KLF5): chemiluminescence-based western blot assay for inhibitors of Early Growth Response 1 (EGR1) protein levels in SW620 human colorectal carcinoma cells

Gene RIF (332)

PMID Text
27002148 in primary cultures of glioma stemlike cells that EGR1 contributes to stemness marker expression and proliferation by orchestrating a PDGFA-dependent growth-stimulatory loop.
26975996 In nucleus pulposus cells early transcriptional programming initiated by EGR1 is essentially restrained by the cells' epigenome as it was determined during development and differentiation.
26792551 Functional changes of EGR1 (and miR-132) during the course of Alzheimer's disease contribute to late neurodegeneration in the nucleus basalis of Meynert.
26720342 C2238/alphaANP downregulates ApoE in vascular smooth muscle cells through type C natriuretic peptide receptor-dependent activation of Egr-1 and the consequent upregulation of miR199a.
26692143 Results indicate that EGR-1 is a transcriptional regulator of MTCH1 and give some clues about the cellular processes in which MTCH1 might participate.
26573109 EGR-1 overexpression in Jurkat cells transfected to express Tax, promoted the activation of several genes, especially those that contained AP-1 (Jun/c-Fos), but knockdown of endogenous EGR-1 by siRNA reduced Tax-mediated JNK-1 transcription.
26538827 mPGES-1 is downregulated via EGR1 and has a role in caffeine inhibition on PGE2 synthesis of HBx hepatocytes
26519755 study provides evidence that hTERT overexpression is responsible for the upregulation of the cysteine protease cathepsin D by regulating EGR-1 to activate invasiveness in cancer progression
26502071 These kinetic data with calf thymus DNA as a competitor suggested that there are millions of high-affinity quasi-specific sites for Egr-1 among the 3 billion bp of genomic DNA.
26498686 Data show that cyclooxygenase2 (COX2)overexpression induces prostaglandin E synthase (PTGES) through early growth response 1 (EGR1) in colorectal cancer cell lines.
More...

AA Sequence

MAAAKAEMQLMSPLQISDPFGSFPHSPTMDNYPKLEEMMLLSNGAPQFLGAAGAPEGSGSNSSSSSSGGG      1 - 70
GGGGGGSNSSSSSSTFNPQADTGEQPYEHLTAESFPDISLNNEKVLVETSYPSQTTRLPPITYTGRFSLE     71 - 140
PAPNSGNTLWPEPLFSLVSGLVSMTNPPASSSSAPSPAASSASASQSPPLSCAVPSNDSSPIYSAAPTFP    141 - 210
TPNTDIFPEPQSQAFPGSAGTALQYPPPAYPAAKGGFQVPMIPDYLFPQQQGDLGLGTPDQKPFQGLESR    211 - 280
TQQPSLTPLSTIKAFATQSGSQDLKALNTSYQSQLIKPSRMRKYPNRPSKTPPHERPYACPVESCDRRFS    281 - 350
RSDELTRHIRIHTGQKPFQCRICMRNFSRSDHLTTHIRTHTGEKPFACDICGRKFARSDERKRHTKIHLR    351 - 420
QKDKKADKSVVASSATSSLSSYPSPVATSYPSPVTTSYPSPATTSYPSPVPTSFSSPGSSTYPSPVHSGF    421 - 490
PSPSVATTYSSVPPAFPAQVSSFPSSAVTNSFSASTGLSDMTATFSPRTIEIC                     491 - 543
//

Text Mined References (361)

PMID Year Title
27002148 2016 A Positive Feed-forward Loop Associating EGR1 and PDGFA Promotes Proliferation and Self-renewal in Glioblastoma Stem Cells.
26975996 2016 EGR1 controls divergent cellular responses of distinctive nucleus pulposus cell types.
26792551 2016 MicroRNA-132 and early growth response-1 in nucleus basalis of Meynert during the course of Alzheimer's disease.
26720342 2015 C2238/?ANP modulates apolipoprotein E through Egr-1/miR199a in vascular smooth muscle cells in vitro.
26692143 2016 Early growth response 1 (EGR-1) is a transcriptional regulator of mitochondrial carrier homolog 1 (MTCH 1)/presenilin 1-associated protein (PSAP).
26573109 2016 Activation of Tax protein by c-Jun-N-terminal kinase is not dependent on the presence or absence of the early growth response-1 gene product.
26538827 2015 Downregulation of mPGES-1 Expression via EGR1 Plays an Important Role in Inhibition of Caffeine on PGE2 Synthesis of HBx(+) Hepatocytes.
26519755 2016 Human telomerase reverse transcriptase (hTERT) promotes cancer invasion by modulating cathepsin D via early growth response (EGR)-1.
26502071 2015 Influence of quasi-specific sites on kinetics of target DNA search by a sequence-specific DNA-binding protein.
26498686 2015 Prostaglandins induce early growth response 1 transcription factor mediated microsomal prostaglandin E2 synthase up-regulation for colorectal cancer progression.
More...