Property Summary

NCBI Gene PubMed Count 38
PubMed Score 136.84
PubTator Score 45.24

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
Breast cancer 1.400 3.9e-11
invasive ductal carcinoma 1.300 7.7e-03

Gene RIF (9)

AA Sequence

MEGVEEKKKEVPAVPETLKKKRRNFAELKIKRLRKKFAQKMLRKARRKLIYEKAKHYHKEYRQMYRTEIR      1 - 70
MARMARKAGNFYVPAEPKLAFVIRIRGINGVSPKVRKVLQLLRLRQIFNGTFVKLNKASINMLRIVEPYI     71 - 140
AWGYPNLKSVNELIYKRGYGKINKKRIALTDNALIARSLGKYGIICMEDLIHEIYTVGKRFKEANNFLWP    141 - 210
FKLSSPRGGMKKKTTHFVEGGDAGNREDQINRLIRRMN                                    211 - 248
//

Text Mined References (48)

PMID Year Title