Property Summary

NCBI Gene PubMed Count 114
Grant Count 22
R01 Count 16
Funding $1,377,268.18
PubMed Score 130.85
PubTator Score 148.31

Knowledge Summary

Patent (3,935)

Gene RIF (115)

PMID Text
26811329 role of GGA3 in the cell surface export of alpha2B-adrenergic receptor
26427149 Common polymorphisms in the ADRA2B gene are not associated with orthostatic hypotension risk in Chinese.
25904801 norepinephrine-related neurogenetic differences enhance the subjective vividness of perceptual experience and its emotional enhancement.
25558682 Polymorphism DD of a gene ADRA2B is a genetic predictor of predisposition to the blockade of the right and left bundle branch block.
25325286 The results of this study suggested that ADRA2B is closely related to the individual difference in human attention orientation, but not to the individual difference in emotional processing.
25127926 ADRA2B deletion carriers showed decreased neural activity in the amygdala when recognizing emotional faces in control condition and increased amygdala activity under stress.
24997351 The ADRA2B deletion variant may selectively predict stress effects on memory in females.
24269973 The ADRA2b deletion variant, which was previously associated with vasoconstriction, to emotional memory and visual perception.
24149058 Carrying the ADRA2B deletion variant enhances the relationship between arousal at encoding and subsequent memory for moderately arousing events.
24114805 A mutation in alpha2B-adrenergic receptor is associated with autosomal dominant cortical myoclonus and epilepsy.
More...

AA Sequence

MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSL      1 - 70
ANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIA     71 - 140
AVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAK    141 - 210
GGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNS    211 - 280
GQGQKEGVCGASPEDEAEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIG    281 - 350
GQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNP    351 - 420
VIYTIFNQDFRRAFRRILCRPWTQTAW                                               421 - 447
//

Text Mined References (114)

PMID Year Title
26811329 2016 GGA3 Interacts with a G Protein-Coupled Receptor and Modulates Its Cell Surface Export.
26427149 2015 Association between Common Genetic Variants of ?2A-, ?2B-, and ?2C-Adrenergic Receptors and Orthostatic Hypotension.
25904801 2015 Neurogenetic variations in norepinephrine availability enhance perceptual vividness.
25558682 2014 [The role of alfa-2-beta-adrenoreceptor in development of ventricular conduction disturbance].
25325286 2014 A 9-nucleotide Ins/Del in ADRA2B modulates orientation of attention to facial expressions and emotional words.
25127926 2015 ADRA2B genotype differentially modulates stress-induced neural activity in the amygdala and hippocampus during emotional memory retrieval.
24997351 2014 ADRA2B deletion variant selectively predicts stress-induced enhancement of long-term memory in females.
24269973 2014 Tuning to the significant: neural and genetic processes underlying affective enhancement of visual perception and memory.
24149058 2014 Deletion variant in the ADRA2B gene increases coupling between emotional responses at encoding and later retrieval of emotional memories.
24114805 2014 The ?2B-adrenergic receptor is mutant in cortical myoclonus and epilepsy.
More...