Property Summary

NCBI Gene PubMed Count 114
PubMed Score 130.85
PubTator Score 148.31

Knowledge Summary

Patent (3,935)

TINX Plot

  Disease (5)

Disease Target Count P-value
psoriasis 6685 3.1e-21
Disease Target Count Z-score Confidence
Epilepsy 346 0.0 4.0

Protein-protein Interaction (200)

GNAT3   GRM8   CORT   CXCR6   CCL21   CXCL11   GRM6   CCL25   CCL16   ADCY6   GALR2   CXCL13   ADCY3   ADCY9   GALR3   GABBR2   S1PR2   ADCY5   S1PR4   AGT   C3   C5   KNG1   POMC   PENK   PDYN   PPY   NPY   PPBP   PF4   CXCL10   ANXA1   GNAI2   APP   CHRM2   CHRM4   GNAI3   CXCL1   SAA1   ADORA3   PYY   CXCL8   CCL5   DRD2   ADRA2C   GNAZ   CXCL2   CXCL3   PMCH   S1PR1   FPR1   CNR1   C5AR1   DRD4   GAL   CXCR1   CXCR2   FPR3   FPR2   ACKR3   NPY1R   BDKRB2   ADORA1   AGTR1   SSTR1   SSTR2   SSTR4   CCR1   CCR7   CXCR5   SSTR3   CNR2   SSTR5   OPRM1   APLNR   DRD3   ADCY8   OPRD1   OPRK1   OPRL1   CASR   CCR2   CXCL5   PTGER3   CCR10   BDKRB1   GALR1   MTNR1A   CXCL12   NPBWR1   NPBWR2   NMU   PIK3CG   HCAR3   NPY2R   MTNR1B   CXCR3   AGTR2   NPY4R   P2RY4   CCR3   CCR4   CCR5   CCR6   CCR8   CCR9   ADCY7   CCL23   TAS2R38   TAS2R39   TAS2R40   TAS2R41   TAS2R43   TAS2R31   TAS2R45   TAS2R46   TAS2R30   TAS2R19   TAS2R20   TAS2R50   TAS2R60   GNG2   CXCR4   SST   GNB1   GNAI1   CCL20   CXCL6   PLCB2   PLCB3   GNA12   CXCL9   ADCY2   ADCY1   GPR17   PNOC   GPR18   GNA13   GRM2   GRM7   GRM3   GRM4   P2RY14   NPY5R   C3AR1   NMS   PIK3R6   TAS2R42   MT-RNR2   NPW   ADCY4   NPB   HCAR2   OXER1   RXFP4   RLN3   PIK3R5   LPAR1   ARHGEF1   MCHR2   OXGR1   S1PR3   GPER1   MCHR1   CCL19   P2RY13   SUCNR1   HCAR1   NMUR2   LPAR5   S1PR5   P2RY12   CXCL16   HRH4   NMUR1   LPAR2   PLCB1   CCL28   HEBP1   RXFP3   TAS2R16   TAS2R14   TAS2R13   TAS2R10   TAS2R9   TAS2R8   TAS2R7   TAS2R5   TAS2R4   TAS2R3   TAS2R1   ARHGEF12   GABBR1   LPAR3   APLN   GPR55   CCL27   HRH3   INSL5   PTGDR2  

Gene RIF (115)

PMID Text
26811329 role of GGA3 in the cell surface export of alpha2B-adrenergic receptor
26427149 Common polymorphisms in the ADRA2B gene are not associated with orthostatic hypotension risk in Chinese.
25904801 norepinephrine-related neurogenetic differences enhance the subjective vividness of perceptual experience and its emotional enhancement.
25558682 Polymorphism DD of a gene ADRA2B is a genetic predictor of predisposition to the blockade of the right and left bundle branch block.
25325286 The results of this study suggested that ADRA2B is closely related to the individual difference in human attention orientation, but not to the individual difference in emotional processing.
25127926 ADRA2B deletion carriers showed decreased neural activity in the amygdala when recognizing emotional faces in control condition and increased amygdala activity under stress.
24997351 The ADRA2B deletion variant may selectively predict stress effects on memory in females.
24269973 The ADRA2b deletion variant, which was previously associated with vasoconstriction, to emotional memory and visual perception.
24149058 Carrying the ADRA2B deletion variant enhances the relationship between arousal at encoding and subsequent memory for moderately arousing events.
24114805 A mutation in alpha2B-adrenergic receptor is associated with autosomal dominant cortical myoclonus and epilepsy.
24087960 Statistically significant prevalence of homozygous genotype DD of ADRA2B gene was found in patients with atrioventricular blocks and sick sinus node syndrome.
24058067 ADRA2B mutations are associated with emotional subjectivity of viusal perception.
23583499 Carriers of the ADRA2B functional deletion variant showed an impaired recognition and slower retrieval of neutral faces under stress.
23499426 this study demonstrated for the first time an independent contribution of the ADRA2B genetic polymorphism to memory impairment and we further suggest a possible protective role of the deletion variant against the disease development.
23225885 Adenosine alpha2B receptor is upregulated in the peripheral blood leukocytes of multiple sclerosis patients.
23105096 The small GTPase Rab26 regulates the Golgi to cell surface traffic of alpha(2)-adrenergic receptors, likely through a physical interaction.
22839581 For the first time, we revealed on clinical - genetic material association between hereditary disturbances of cardiac conduction and polymorphism of 2-adrenergic receptor gene.
22743060 Activation of the adenosine A(2B) receptor protects against vascular injury, while it also enhances plaque stability as indicated by increased collagen content.
22701600 Adenosine A(2B) receptor signaling plays a role in regulating placental 11beta-hydroxysteroid dehydrogenase type 2 expression, and consequently fetal development.
22570080 Molecular dynamics simulations of palmitoylated/glycosylated, membrane-integrated human A(2B)AR in its native environment is a possible approach and this model can be used for designing potent and selective A(2B)AR antagonists.
22560155 The ADRA2A and ADRA2C polymorphisms did not contribute to an increased risk of ischemic stroke or any pathophysiological subtype
22404651 A triple arg motif mediates alpha(2B)-adrenergic receptor interaction with Sec24C/D and export
22218095 this study found significant effects of ADRA2B haplotype polymorphisms on response inhibition in a large Chinese sample, with the minor AAGG haplotype associated with shorter SSR.
22170367 Variability in the acute blood pressure response to coffee may be partly explained by genetic polymorphisms of the adenosine A2A receptors and alpha(2)-adrenergic receptors.
22025613 Data strongly demonstrate that the small GTPase ARF1 modulates ERK1/2 activation by alpha(2B)-AR and provide the first evidence indicating a novel function for ARF1 in regulating the MAPK signaling pathway.
21965191 There were no main effects or interactions in relation to ADRA2B genotype.
21942960 Was detected polymorphisms of ADRA2B in patients with atrial fibrillation.
21878072 ADRA2B gene polymorphism might be associated with the hereditary sick sinus node syndrome.
21854681 The significant novel finding from this study is that the affective modulation of T2 detection is influenced by a non-additive (epistatic) interaction between the ADRA2B and 5-HTTLPR insertion/deletion polymorphisms.
21357695 Alpha2B-adrenergic receptor interaction with tubulin controls its transport from the endoplasmic reticulum to the cell surface
21259387 the ADRA2B polymorphism influences emotional memory formation but not memory retrieval in the amygdala and left inferior frontal gyrus.
21159032 Data do not show any association between the presence of the alpha2B-adrenergic receptor deletion allele and the occurrence of spontaneous abortions.
20739228 The noradrenaline-mediated depolarization of vascular smooth muscle cells is produced by activation of both alpha(1)-and alpha(2)-adrenoceptors.
20705341 Observational study of gene-disease association. (HuGE Navigator)
20692245 Homozygote for insertion [I]/deletion allele of alpha(2B)-AR gene polymorphism is associated with silent myocardial ischemia in type 2 diabetes mellitus patients with coronary artery disease.
20692245 Observational study of gene-disease association. (HuGE Navigator)
20651814 the findings of this study do not support a functional significance of ADRA2B indel polymorphism at position -4825 relative to the start codon in the far upstream region of the promoter in the present migraine subjects.
20651814 Observational study of gene-disease association. (HuGE Navigator)
20613626 Observational study of gene-disease association. (HuGE Navigator)
20424170 Data provide strong evidence indicating that Rab8 GTPase interacts with distinct motifs in the C termini of alpha(2B)-AR and beta(2)-AR and differentially modulates their traffic from the TGN to the cell surface.
20401689 gene x exercise interactions were observed for A2BGlu9/12 and B2Gln27Glu on change in lean soft tissue (LST, p = 0.02); exercisers on the A2BGlu9- background gained LST compared to a loss among controls over 12 months (p\0.05)
20110158 carriage of the ADRA2B deletion abolished the relative memory impairment in homozygous COMT val158 carriers compared to met158 carriers.
20110158 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20051907 The ADRA2B 301-303 deletion allele (ins/del and del/del, n = 18) was associated with resistance to desensitization.
20051907 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20044737 Meta-analysis of gene-disease association. (HuGE Navigator)
19874574 Observational study of gene-disease association. (HuGE Navigator)
19826083 A functional deletion variant of ADRA2B is related to increased responsivity and connectivity of brain regions implicated in emotional memory.
19826083 Observational study of gene-disease association. (HuGE Navigator)
19815603 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19781422 Observational study of gene-disease association. (HuGE Navigator)
19728989 A novel polymorphism in the coding region of the human alpha-2B adrenergic receptor has been identified and demonstrated to affect receptor function.
19593211 The I/D polymorphism is not consistently associated with metabolic syndrome and metabolic/anthropometric parameters but with diastolic blood pressure in an urban-based population of middle-aged Swedes.
19593211 Observational study of gene-disease association. (HuGE Navigator)
19477404 The alpha(2C) Del322-325 polymorphism exclusively or in combination with the beta(1)Arg389 allele is not associated with an increased risk of adverse events in HF.
19352218 Observational study of gene-disease association. (HuGE Navigator)
19056576 Clinical trial of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18953403 A variant of the ADRA2B gene is associated with essential hypertension with or without type 2 diabetes in Malaysian subjects.
18953403 Observational study of gene-disease association. (HuGE Navigator)
18854756 The ADRA2B D allele is associated with a favorable anthropometric and metabolic profile in Chinese population.
18854756 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18596718 we could not replicate the association of blood pressure and the metabolic phenotypes with ADRA2B I/D polymorphism
18596718 Observational study of gene-disease association. (HuGE Navigator)
18456256 A vascular smooth muscle cell line stably expressing the human alpha 2B-adrenoceptor was generated by transfection of rat cells
18054844 These data indicate that alpha-2 adrenergic receptors contribute significantly to CBR-induced vasoconstriction in the human leg under resting conditions.
17660814 a deletion variant of ADRA2B, the gene encoding the alpha2b-adrenergic receptor, is related to enhanced emotional memory in healthy Swiss subjects and in survivors of the Rwandan civil war who experienced highly aversive emotional situations.
17625217 {alpha}2-adrenergic receptor-mediated antilipolysis in human adipose tissue is inhibited by long chain fatty acids
17620957 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17620957 main finding was that men with the DD polymorphism of the ADRA2B gene and job strain have significantly higher blood pressure than all other gene-work characteristics combinations
17595424 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17595424 The decrease in intermuscular fat (IMF) in ADRalpha2bGlu9 carriers was significantly different from a nonsignificant increase in ADRalpha2bGlu9 noncarriers.
17516297 Observational study of gene-disease association. (HuGE Navigator)
17516297 Evidence for an association of the D allele with both presence and severity of neuropathy in patients with type 2 diabetes mellitus.
17410123 alpha-2CDel AR appears to play only a minor role in presynaptic regulation of NA release and/or to be not hypofunctional in vivo in humans, but functional responsiveness of presynaptic alpha-2 AR declines with ageing.
17370102 study showed that genotype distribution and the frequency of the alpha 2 beta adrenergic receptor alleles was not different in Greek women with polycystic ovary syndrome and controls
17277585 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17277585 Leisure-time physical activity decreased the risk of type 2 diabetes in those with the 12Glu and 9Glu alleles of the ADRA2B gene.
17039423 Observational study of gene-disease association. (HuGE Navigator)
17039423 Multiple stepwise linear regression identified alpha2B genotype as an independent predictor of age at onset of type 2 diabetes.
16907703 Observational study of gene-disease association. (HuGE Navigator)
16776624 Observational study of gene-disease association. (HuGE Navigator)
16645408 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
16336817 Observational study of gene-disease association. (HuGE Navigator)
16269962 Observational study of gene-disease association. (HuGE Navigator)
16269962 In Chinese men, the I allele of the ADRA2B gene is associated with higher blood pressure, but also with a more favourable metabolic phenotype.
16247508 Observational study of gene-disease association. (HuGE Navigator)
15920038 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15900285 Observational study of gene-disease association. (HuGE Navigator)
15900214 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15893292 analysis of stability of ADRA2B and binding to small molecules after detergent solubilization
15864138 Observational study of gene-disease association. (HuGE Navigator)
15864122 Observational study of gene-environment interaction. (HuGE Navigator)
15864122 the del301-303 polymorphism of ADRA2B does not contribute significantly to interindividual in vivo variability in response to alpha2-AR activation in the hand vein
15731590 Observational study of gene-environment interaction and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15719258 Observational study of gene-disease association. (HuGE Navigator)
15592690 Observational study of genotype prevalence. (HuGE Navigator)
15592690 ADRA2A and ADRA2B each had a single haplotype block at least 11 and 16 kb in size
15309292 Observational study of gene-disease association. (HuGE Navigator)
15309292 The 12Glu9 polymorphism of ADRA2B is associated with impaired insulin secretion and may predict the development of Type 2 diabetes.
15166301 Observational study of gene-disease association. (HuGE Navigator)
15166301 body fat response to exercise training in older adults is associated with the combined effects of the Glu12/Glu9 alpha2b-adrenergic receptor, Trp64Arg beta3-adrenergic receptor, and Gln27Glu beta2-adrenergic receptor gene variants
14744925 Observational study of gene-disease association. (HuGE Navigator)
14744925 A polymorphism in the (alpha)2B adrenoceptor gene associates with hypertension.
12946937 Alpha2-ARs in vascular smooth muscle cells reflect differential activity of alpha2-AR gene promoters. Alpha2C-ARs can be induced via p38 MAPK-dependent pathway.
12917501 Observational study of gene-disease association. (HuGE Navigator)
12822042 No major functional significance of the alpha(2B) adrenergic receptor polymorphism in the present sample of morbidly obese subjects was found.
12629104 Observational study of gene-disease association. (HuGE Navigator)
12535806 Observational study of gene-disease association. (HuGE Navigator)
12535806 Middle-aged white men carrying the DD genotype of the alpha(2B)-AR have a significantly increased risk for sudden cardiac death and myocardial infarction, especially before the age of 55 years.
12519093 Observational study of gene-environment interaction. (HuGE Navigator)
12401126 Observational study of gene-disease association. (HuGE Navigator)
11753579 Observational study of gene-disease association. (HuGE Navigator)
11345359 Observational study of gene-disease association. (HuGE Navigator)
11140838 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)

AA Sequence

MDHQDPYSVQATAAIAAAITFLILFTIFGNALVILAVLTSRSLRAPQNLFLVSLAAADILVATLIIPFSL      1 - 70
ANELLGYWYFRRTWCEVYLALDVLFCTSSIVHLCAISLDRYWAVSRALEYNSKRTPRRIKCIILTVWLIA     71 - 140
AVISLPPLIYKGDQGPQPRGRPQCKLNQEAWYILASSIGSFFAPCLIMILVYLRIYLIAKRSNRRGPRAK    141 - 210
GGPGQGESKQPRPDHGGALASAKLPALASVASAREVNGHSKSTGEKEEGETPEDTGTRALPPSWAALPNS    211 - 280
GQGQKEGVCGASPEDEAEEEEEEEEECEPQAVPVSPASACSPPLQQPQGSRVLATLRGQVLLGRGVGAIG    281 - 350
GQWWRRRAQLTREKRFTFVLAVVIGVFVLCWFPFFFSYSLGAICPKHCKVPHGLFQFFFWIGYCNSSLNP    351 - 420
VIYTIFNQDFRRAFRRILCRPWTQTAW                                               421 - 447
//

Text Mined References (114)

PMID Year Title
26811329 2016 GGA3 Interacts with a G Protein-Coupled Receptor and Modulates Its Cell Surface Export.
26427149 2015 Association between Common Genetic Variants of ?2A-, ?2B-, and ?2C-Adrenergic Receptors and Orthostatic Hypotension.
25904801 2015 Neurogenetic variations in norepinephrine availability enhance perceptual vividness.
25558682 2014 [The role of alfa-2-beta-adrenoreceptor in development of ventricular conduction disturbance].
25325286 2014 A 9-nucleotide Ins/Del in ADRA2B modulates orientation of attention to facial expressions and emotional words.
25127926 2015 ADRA2B genotype differentially modulates stress-induced neural activity in the amygdala and hippocampus during emotional memory retrieval.
24997351 2014 ADRA2B deletion variant selectively predicts stress-induced enhancement of long-term memory in females.
24269973 2014 Tuning to the significant: neural and genetic processes underlying affective enhancement of visual perception and memory.
24149058 2014 Deletion variant in the ADRA2B gene increases coupling between emotional responses at encoding and later retrieval of emotional memories.
24114805 2014 The ?2B-adrenergic receptor is mutant in cortical myoclonus and epilepsy.
24087960 2013 [?-2?-adrenoreceptor gene polymorphism in patients with disorders of cardiac conduction].
24058067 2013 Genes for emotion-enhanced remembering are linked to enhanced perceiving.
23583499 2013 ADRA2B genotype modulates effects of acute psychosocial stress on emotional memory retrieval in healthy young men.
23499426 2013 The deletion variant of ?2b-adrenergic receptor is associated with decreased risk in Alzheimer's disease and mild cognitive impairment.
23225885 2013 Blocking A2B adenosine receptor alleviates pathogenesis of experimental autoimmune encephalomyelitis via inhibition of IL-6 production and Th17 differentiation.
23105096 2012 Rab26 modulates the cell surface transport of ?2-adrenergic receptors from the Golgi.
22839581 2012 [Association of 2B-adrenergic receptor gene polymorphism with disturbances of cardiac conduction].
22743060 2012 Adenosine A?B receptor agonism inhibits neointimal lesion development after arterial injury in apolipoprotein E-deficient mice.
22701600 2012 Caffeine reduces 11?-hydroxysteroid dehydrogenase type 2 expression in human trophoblast cells through the adenosine A(2B) receptor.
22570080 2012 Characterization of adenosine receptor in its native environment: insights from molecular dynamics simulations of palmitoylated/glycosylated, membrane-integrated human A(2B) adenosine receptor.
22560155 2013 Association between common genetic variants of ?2A-, ?2B-, and ?2C-adrenergic receptors and ischemic stroke.
22404651 2012 A triple arg motif mediates ?(2B)-adrenergic receptor interaction with Sec24C/D and export.
22218095 2012 Haplotype polymorphism in the alpha-2B-adrenergic receptor gene influences response inhibition in a large Chinese sample.
22170367 2012 Genetic determinants of blood pressure responses to caffeine drinking.
22025613 2011 Regulation of ?(2B)-adrenergic receptor-mediated extracellular signal-regulated kinase 1/2 (ERK1/2) activation by ADP-ribosylation factor 1.
21965191 2012 Influence of COMT val158met and ADRA2B deletion polymorphisms on recollection and familiarity components of human emotional memory.
21942960 2011 [Polymorphisms of ?-2-?-adrenergic receptor and endothelial NO-synthase genes in patients with atrial fibrillation].
21878072 2011 [Polymorphisms of 2B-adrenergic receptor and endothelial NO-Synthase genes in genesis of the hereditary sick sinus node syndrome].
21854681 2012 Epistasis between 5-HTTLPR and ADRA2B polymorphisms influences attentional bias for emotional information in healthy volunteers.
21357695 2011 Alpha2B-adrenergic receptor interaction with tubulin controls its transport from the endoplasmic reticulum to the cell surface.
21259387 2011 Genetic variation of the ?2b-adrenoceptor affects neural correlates of successful emotional memory formation.
21159032 2011 Alpha2B-adrenergic receptor insertion/deletion polymorphism in women with spontaneous recurrent abortions.
20739228 2011 Two mechanisms underlie the slow noradrenergic depolarization in the rat tail artery in vitro.
20705341 2010 Association between genetic polymorphisms of adrenergic receptor and diurnal intraocular pressure in Japanese normal-tension glaucoma.
20692245 2010 Insertion/insertion genotype of ?(2B)-adrenergic receptor gene polymorphism is associated with silent myocardial ischemia in patients with type 2 diabetes mellitus.
20651814 2010 Lack of association between ADRA2B-4825 gene insertion/deletion polymorphism and migraine in Chinese Han population.
20613626 2010 Resting sympathetic nerve activity is related to age, sex and arterial pressure but not to ?2-adrenergic receptor subtype.
20424170 2010 Rab8 interacts with distinct motifs in alpha2B- and beta2-adrenergic receptors and differentially modulates their transport.
20401689 2010 Lifestyle modifies the relationship between body composition and adrenergic receptor genetic polymorphisms, ADRB2, ADRB3 and ADRA2B: a secondary analysis of a randomized controlled trial of physical activity among postmenopausal women.
20110158 2010 Deletion variant of alpha2b-adrenergic receptor gene moderates the effect of COMT val(158)met polymorphism on episodic memory performance.
20051907 2010 Desensitization of vascular response in vivo: contribution of genetic variation in the [alpha]2B-adrenergic receptor subtype.
20044737 2010 Synopsis and data synthesis of genetic association studies in hypertension for the adrenergic receptor family genes: the CUMAGAS-HYPERT database.
19874574 2009 Genetical genomic determinants of alcohol consumption in rats and humans.
19826083 2009 A genetic variation of the noradrenergic system is related to differential amygdala activation during encoding of emotional memories.
19815603 2010 Lack of association between the cholesteryl ester transfer protein gene--TaqIB polymorphism and coronary restenosis following percutaneous transluminal coronary angioplasty and stenting: a pilot study.
19781422 2009 Insertion/deletion polymorphism in alpha2-adrenergic receptor gene is a genetic risk factor for sudden cardiac death.
19728989 2010 Identification of a novel 12-nucleotide insertion polymorphism in the promoter region of ADRA2B: full linkage with the 9-nucleotide deletion in the coding region and influence on transcriptional activity.
19593211 2009 Chromosome 2q12, the ADRA2B I/D polymorphism and metabolic syndrome.
19477404 2009 Polymorphisms of adrenoceptors are not associated with an increased risk of adverse event in heart failure: a MERIT-HF substudy.
19477270 2009 Interaction of the ubiquitin carboxyl terminal esterase L1 with alpha(2)-adrenergic receptors inhibits agonist-mediated p44/42 MAP kinase activation.
19352218 2009 Candidate gene analysis in an on-going genome-wide association study of attention-deficit hyperactivity disorder: suggestive association signals in ADRA1A.
19056576 2009 Effects of novel capsinoid treatment on fatness and energy metabolism in humans: possible pharmacogenetic implications.
18996102 2009 Physiogenomic comparison of edema and BMI in patients receiving rosiglitazone or pioglitazone.
18953403 2008 Association of insertion/deletion polymorphism of alpha-adrenoceptor gene in essential hypertension with or without type 2 diabetes mellitus in Malaysian subjects.
18854756 2008 Anthropometric and metabolic phenotypes in relation to the ADRA2B deletion/insertion polymorphism in Chinese population.
18596718 2008 Blood pressure and metabolic phenotypes in relation to the ADRB1 Arg389Gly and ADRA2B I/D polymorphisms in a White population.
18456256 2008 Expression and characterization of the human alpha 2B-adrenoceptor in a vascular smooth muscle cell line.
18240029 2008 Reviews in molecular biology and biotechnology: transmembrane signaling by G protein-coupled receptors.
18054844 2008 Diminished baroreflex-induced vasoconstriction following alpha-2 adrenergic receptor blockade in humans.
17660814 2007 A deletion variant of the alpha2b-adrenoceptor is related to emotional memory in Europeans and Africans.
17625217 2007 Acute exposure to long-chain fatty acids impairs {alpha}2-adrenergic receptor-mediated antilipolysis in human adipose tissue.
17620957 2007 Job strain, decision latitude and alpha2B-adrenergic receptor polymorphism significantly interact, and associate with higher blood pressures in men.
17595424 2007 Adrenergic receptor genotype influence on midthigh intermuscular fat response to strength training in middle-aged and older adults.
17516297 2007 An insertion/deletion polymorphism in the alpha2B adrenoceptor gene is associated with peripheral neuropathy in patients with type 2 diabetes mellitus.
17410123 2007 Presynaptic alpha-2C adrenoceptor-mediated control of noradrenaline release in humans: genotype- or age-dependent?
17370102 2007 alpha 2 beta adrenoreceptor 301-303 deletion polymorphism in polycystic ovary syndrome.
17277585 2007 Physical activity, diet, and incident diabetes in relation to an ADRA2B polymorphism.
17215105 2007 Delayed transactivation of the receptor for nerve growth factor is required for sustained signaling and differentiation by alpha2-adrenergic receptors in transfected PC12 cells.
17039423 2006 An insertion/deletion polymorphism in the alpha2B adrenoceptor gene is associated with age at onset of type 2 diabetes mellitus.
16907703 2006 Adrenergic receptor polymorphisms associated with resting heart rate: the HyperGEN Study.
16776624 2006 Lack of association between alpha2B-adrenergic receptor polymorphism and risk of restenosis following coronary angioplasty and stent implantation--preliminary report.
16645408 2006 Alpha- and beta-adrenergic receptor polymorphisms in hypertensive and normotensive offspring.
16531006 2006 Interaction of the amyloid precursor like protein 1 with the alpha2A-adrenergic receptor increases agonist-mediated inhibition of adenylate cyclase.
16336817 2005 ADRA2B gene insertion/deletion polymorphism and artery compliance.
16269962 2005 Cardiovascular and metabolic phenotypes in relation to the ADRA2B insertion/deletion polymorphism in a Chinese population.
16247508 2006 Alpha2B-adrenergic receptor deletion polymorphism and cardiac autonomic nervous system responses to exercise in obese women.
15920038 2005 Genetic variation at the human alpha2B-adrenergic receptor locus: role in blood pressure variation and yohimbine response.
15900285 2005 Human response to alpha2-adrenergic agonist stimulation studied in an isolated vascular bed in vivo: Biphasic influence of dose, age, gender, and receptor genotype.
15900214 2005 Variation in the alpha2B-adrenergic receptor gene (ADRA2B) and its relationship to vascular response in vivo.
15893292 2005 Functional studies with membrane-bound and detergent-solubilized alpha2-adrenergic receptors expressed in Sf9 cells.
15864138 2005 Alpha-2B adrenoceptor polymorphism and peripheral vasoconstriction.
15864122 2005 Alpha2B adrenergic receptor 301-303 deletion polymorphism and vascular alpha2 adrenergic receptor response.
15815621 2005 Generation and annotation of the DNA sequences of human chromosomes 2 and 4.
15731590 2005 Effect of alpha2B-adrenoceptor polymorphism on peripheral vasoconstriction in healthy volunteers.
15719258 2005 Functional adrenergic receptor polymorphisms and idiopathic orthostatic intolerance.
15592690 2005 Haplotype-based analysis of alpha 2A, 2B, and 2C adrenergic receptor genes captures information on common functional loci at each gene.
15309292 2004 Association between a deletion/insertion polymorphism in the alpha2B-adrenergic receptor gene and insulin secretion and Type 2 diabetes. The Finnish Diabetes Prevention Study.
15166301 2004 Association between body fat response to exercise training and multilocus ADR genotypes.
15037199 2004 Cloning, characterisation and identification of several polymorphisms in the promoter region of the human alpha2B-adrenergic receptor gene.
14744925 2004 Functional variant in the (alpha)2B adrenoceptor gene, a positional candidate on chromosome 2, associates with hypertension.
12946937 2004 Regulation of alpha(2)-adrenoceptors in human vascular smooth muscle cells.
12917501 2003 A deletion in the alpha2B-adrenergic receptor gene and autonomic nervous function in central obesity.
12822042 2003 The alpha2B adrenergic receptor deletion/insertion polymorphism in morbid obesity.
12629104 2003 Alpha(2B)-adrenergic receptor deletion polymorphism associates with autonomic nervous system activity in young healthy Japanese.
12535806 2003 Variation in the alpha2B-adrenoceptor gene as a risk factor for prehospital fatal myocardial infarction and sudden cardiac death.
12519093 2003 Effects of common polymorphisms in the alpha1A-, alpha2B-, beta1- and beta2-adrenoreceptors on haemodynamic responses to adrenaline.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12401126 2002 Deletion polymorphism in the alpha2B-adrenergic receptor gene is associated with flow-mediated dilatation of the brachial artery.
11753579 2001 Effect of a three-amino acid deletion in the alpha2B-adrenergic receptor gene on long-term body weight change in Finnish non-diabetic and type 2 diabetic subjects.
11345359 2001 An insertion/deletion polymorphism in the alpha2B-adrenergic receptor gene is a novel genetic risk factor for acute coronary events.
11313909 2001 G(z) signaling: emerging divergence from G(i) signaling.
11140838 2000 A multivariate analysis of 59 candidate genes in personality traits: the temperament and character inventory.
11056163 2001 Polymorphic deletion of three intracellular acidic residues of the alpha 2B-adrenergic receptor decreases G protein-coupled receptor kinase-mediated phosphorylation and desensitization.
10647009 1999 Two functionally distinct alpha2-adrenergic receptors regulate sympathetic neurotransmission.
10404816 1999 Identification of a three-amino acid deletion in the alpha2B-adrenergic receptor that is associated with reduced basal metabolic rate in obese subjects.
10224112 1999 The zeta isoform of 14-3-3 proteins interacts with the third intracellular loop of different alpha2-adrenergic receptor subtypes.
9435676 1997 Regulation of adenylyl cyclase in polarized renal epithelial cells by G protein-coupled receptors.
9235896 1997 A novel interaction between adrenergic receptors and the alpha-subunit of eukaryotic initiation factor 2B.
3012234 1986 Alpha-2 adrenergic receptor subtypes indicated by [3H]yohimbine binding in human brain.
2842764 1988 Cloning and expression of a human kidney cDNA for an alpha 2-adrenergic receptor subtype.
2173582 1990 In vitro amplification by polymerase chain reaction of a partial gene encoding the third subtype of alpha-2 adrenergic receptor in humans.
2172775 1990 Cloning, expression, and pharmacological characterization of a human alpha 2B-adrenergic receptor.
2169434 1990 The alpha 2B adrenergic receptor of undifferentiated neuroblastoma x glioma hybrid NG108-15 cells, interacts directly with the guanine nucleotide binding protein, Gi2.
2164221 1990 Expansion of the alpha 2-adrenergic receptor family: cloning and characterization of a human alpha 2-adrenergic receptor subtype, the gene for which is located on chromosome 2.