Property Summary

NCBI Gene PubMed Count 34
PubMed Score 38.03
PubTator Score 43.35

Knowledge Summary


No data available


  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 4.22783429349464E-12
juvenile dermatomyositis 1189 6.89559766549308E-11
lung adenocarcinoma 2714 1.21870546734037E-9
medulloblastoma 1524 2.59337931537445E-6
tuberculosis and treatment for 6 months 686 7.71463640235004E-6
Duchenne muscular dystrophy 602 1.28924901321276E-5
ovarian cancer 8492 1.4885420011542E-5
acute quadriplegic myopathy 1157 4.39099274167069E-5
pediatric high grade glioma 2712 1.01645424372692E-4
glioblastoma 5572 7.82794476824314E-4
dermatomyositis 967 0.00121755259607916
pilocytic astrocytoma 3086 0.00174723285642343
osteosarcoma 7933 0.00191770633119808
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00335989987608196
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00696688719597758
non primary Sjogren syndrome sicca 840 0.0153466464139837
Breast cancer 3099 0.0226493960636325
spina bifida 1064 0.0460300973724024



Accession P18085 B2R7J7 P21371
Symbols ARF2




  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (10)

24185178 A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity.
23783033 ARF1+ARF4 are required for integrity of recycling endosomes but are involved in distinct transport pathways: the pair regulates retrograde transport from endosomes to the TGN.
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 4 (ARF4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22185782 The lipid droplets deposition and the cellular triacylglycerol content are significantly increased by siRNA-mediated depletion of Arf4.
22105072 a crucial role for class II Arf proteins (Arf4 and Arf5) in the dengue flavivirus life cycle
22004728 sLZIP-regulated ARF4 expression in response to phorbol 12-myristate 13-acetate is involved in breast cancer cell migration.
20881058 Arf4 regulates PLA2G6-A activity together with Arf1; and gene silencing of Arf4 was shown to alter cytosolic coat protein I subunit recruitment to the early secretory pathway.
19041174 ARF4 participates in the regulation of glioblastoma apoptosis through the inhibition of stress-mediated apoptotic signals
15049518 ARF4L occurred on the plasma membrane after binding to GTP and into endosomes while binding to GDP; the inactive form of ARF4L causes localization of transferrin receptors to the endosomes while the active form causes transport to the plasma membrane.
12446727 ARF4 is a critical molecule that directly regulates cellular phospholipase D2 activity and this ARF4-mediated PLD2 activation stimulates AP-1-dependent transcription in the EGF-induced cellular response

AA Sequence

DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR                                  141 - 180

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24185178 2013 A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23783033 2013 ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23050017 2012 Arf4 determines dentate gyrus-mediated pattern separation by regulating dendritic spine development.
22185782 2011 GBF1-Arf-COPI-ArfGAP-mediated Golgi-to-ER transport involved in regulation of lipid homeostasis.
22105072 2012 Class II ADP-ribosylation factors are required for efficient secretion of dengue viruses.
22004728 2012 Regulation of ADP-ribosylation factor 4 expression by small leucine zipper protein and involvement in breast cancer cell migration.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21269460 2011 Initial characterization of the human central proteome.
20881058 2010 ADP ribosylation factors 1 and 4 and group VIA phospholipase A? regulate morphology and intraorganellar traffic in the endoplasmic reticulum-Golgi intermediate compartment.
20458337 MHC class II-associated proteins in B-cell exosomes and potential functional implications for exosome biogenesis.
19946888 2010 Defining the membrane proteome of NK cells.
19041174 2009 Identification of ADP-ribosylation factor 4 as a suppressor of N-(4-hydroxyphenyl)retinamide-induced cell death.
17956946 2007 Dissecting the role of the ARF guanine nucleotide exchange factor GBF1 in Golgi biogenesis and protein trafficking.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15049518 2004 Role of ARF4L in recycling between endosomes and the plasma membrane.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12446727 2003 ADP-ribosylation factor 4 small GTPase mediates epidermal growth factor receptor-dependent phospholipase D2 activation.
11481332 2001 Identification of a novel Rab11/25 binding domain present in Eferin and Rip proteins.
10828067 2000 Interaction of GRASP, a protein encoded by a novel retinoic acid-induced gene, with members of the cytohesin family of guanine nucleotide exchange factors.
10593962 1999 Identification of arfophilin, a target protein for GTP-bound class II ADP-ribosylation factors.
10524252 1999 Cloning and characterization of the human ADP-ribosylation factor 4 gene.
10099884 1998 Human ADP-ribosylation factor 4 (ARF4) gene. Map position 3p14.1.
9180902 1997 Differential gene expression in SV40-mediated immortalization of human fibroblasts.
8491770 1993 Two distinct populations of ARF bound to Golgi membranes.
8355790 1993 Coated vesicle assembly in the Golgi requires only coatomer and ARF proteins from the cytosol.
7956370 1995 Localization of human ARF2 and NCK genes and 13 other NotI-linking clones to chromosome 3 by fluorescence in situ hybridization.
2107548 1990 Selective amplification of an mRNA and related pseudogene for a human ADP-ribosylation factor, a guanine nucleotide-dependent protein activator of cholera toxin.
2105501 1990 ADP-ribosylation factor is functionally and physically associated with the Golgi complex.
1899243 1991 Human ADP-ribosylation factors. A functionally conserved family of GTP-binding proteins.
1447192 1992 Human and Giardia ADP-ribosylation factors (ARFs) complement ARF function in Saccharomyces cerevisiae.