Property Summary

NCBI Gene PubMed Count 36
PubMed Score 46.58
PubTator Score 43.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Disease log2 FC p
acute quadriplegic myopathy 1.469 1.8e-05
autosomal dominant Emery-Dreifuss muscul... 1.239 3.4e-03
Breast cancer 3.400 2.3e-02
breast carcinoma 1.100 4.2e-12
dermatomyositis 1.400 1.2e-03
Duchenne muscular dystrophy 1.069 1.3e-05
glioblastoma 1.400 9.4e-07
group 3 medulloblastoma 1.400 2.2e-02
intraductal papillary-mucinous neoplasm ... 1.400 7.0e-03
juvenile dermatomyositis 1.274 6.9e-11
lung adenocarcinoma 1.637 1.2e-09
non primary Sjogren syndrome sicca 1.400 1.5e-02
osteosarcoma 1.411 1.9e-03
ovarian cancer -1.100 7.1e-03
pediatric high grade glioma 1.500 1.0e-04
Pilocytic astrocytoma 1.100 1.7e-03
spina bifida -1.247 4.6e-02
tuberculosis and treatment for 6 months -1.100 7.7e-06

Gene RIF (11)

AA Sequence

MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG      1 - 70
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT     71 - 140
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR                                  141 - 180
//

Text Mined References (42)

PMID Year Title