Property Summary

NCBI Gene PubMed Count 34
Grant Count 19
R01 Count 12
Funding $1,079,953.5
PubMed Score 38.03
PubTator Score 43.35

Knowledge Summary

Patent

No data available

Expression

Gene RIF (13)

PMID Text
24185178 A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity.
23783033 ARF1+ARF4 are required for integrity of recycling endosomes but are involved in distinct transport pathways: the pair regulates retrograde transport from endosomes to the TGN.
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 4 (ARF4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 4 (ARF4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 4 (ARF4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 4 (ARF4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22185782 The lipid droplets deposition and the cellular triacylglycerol content are significantly increased by siRNA-mediated depletion of Arf4.
22105072 a crucial role for class II Arf proteins (Arf4 and Arf5) in the dengue flavivirus life cycle
22004728 sLZIP-regulated ARF4 expression in response to phorbol 12-myristate 13-acetate is involved in breast cancer cell migration.
20881058 Arf4 regulates PLA2G6-A activity together with Arf1; and gene silencing of Arf4 was shown to alter cytosolic coat protein I subunit recruitment to the early secretory pathway.
More...

AA Sequence

MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG      1 - 70
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT     71 - 140
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR                                  141 - 180
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24185178 2013 A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23783033 2013 ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...