Property Summary

NCBI Gene PubMed Count 34
PubMed Score 38.03
PubTator Score 43.35

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
breast carcinoma 1614 4.22783429349464E-12
juvenile dermatomyositis 1189 6.89559766549308E-11
lung adenocarcinoma 2714 1.21870546734037E-9
medulloblastoma 1524 2.59337931537445E-6
tuberculosis and treatment for 6 months 686 7.71463640235004E-6
Duchenne muscular dystrophy 602 1.28924901321276E-5
ovarian cancer 8492 1.4885420011542E-5
acute quadriplegic myopathy 1157 4.39099274167069E-5
pediatric high grade glioma 2712 1.01645424372692E-4
glioblastoma 5572 7.82794476824314E-4
dermatomyositis 967 0.00121755259607916
pilocytic astrocytoma 3086 0.00174723285642343
osteosarcoma 7933 0.00191770633119808
autosomal dominant Emery-Dreifuss muscular dystrophy 499 0.00335989987608196
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00696688719597758
non primary Sjogren syndrome sicca 840 0.0153466464139837
Breast cancer 3099 0.0226493960636325
spina bifida 1064 0.0460300973724024

Expression

Synonym

Accession P18085 B2R7J7 P21371
Symbols ARF2

Gene

PDB

1Z6X  

  Ortholog (8)

Species Source
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Cow OMA Inparanoid
Opossum OMA Inparanoid
Chicken OMA Inparanoid
Xenopus OMA Inparanoid
C. elegans OMA Inparanoid

Gene RIF (10)

PMID Text
24185178 A CREB3-ARF4 signalling cascade may be part of a Golgi stress response set in motion by stimuli compromising Golgi capacity.
23783033 ARF1+ARF4 are required for integrity of recycling endosomes but are involved in distinct transport pathways: the pair regulates retrograde transport from endosomes to the TGN.
23125841 Tandem affinity purification and mass spectrometry analysis identify ADP-ribosylation factor 4 (ARF4), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22185782 The lipid droplets deposition and the cellular triacylglycerol content are significantly increased by siRNA-mediated depletion of Arf4.
22105072 a crucial role for class II Arf proteins (Arf4 and Arf5) in the dengue flavivirus life cycle
22004728 sLZIP-regulated ARF4 expression in response to phorbol 12-myristate 13-acetate is involved in breast cancer cell migration.
20881058 Arf4 regulates PLA2G6-A activity together with Arf1; and gene silencing of Arf4 was shown to alter cytosolic coat protein I subunit recruitment to the early secretory pathway.
19041174 ARF4 participates in the regulation of glioblastoma apoptosis through the inhibition of stress-mediated apoptotic signals
15049518 ARF4L occurred on the plasma membrane after binding to GTP and into endosomes while binding to GDP; the inactive form of ARF4L causes localization of transferrin receptors to the endosomes while the active form causes transport to the plasma membrane.
12446727 ARF4 is a critical molecule that directly regulates cellular phospholipase D2 activity and this ARF4-mediated PLD2 activation stimulates AP-1-dependent transcription in the EGF-induced cellular response

AA Sequence

MGLTISSLFSRLFGKKQMRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNICFTVWDVGG      1 - 70
QDRIRPLWKHYFQNTQGLIFVVDSNDRERIQEVADELQKMLLVDELRDAVLLLFANKQDLPNAMAISEMT     71 - 140
DKLGLQSLRNRTWYVQATCATQGTGLYEGLDWLSNELSKR                                  141 - 180
//

Text Mined References (40)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25416956 2014 A proteome-scale map of the human interactome network.
25255805 2014 Global profiling of co- and post-translationally N-myristoylated proteomes in human cells.
24768165 2014 WLS retrograde transport to the endoplasmic reticulum during Wnt secretion.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24185178 2013 A CREB3-ARF4 signalling pathway mediates the response to Golgi stress and susceptibility to pathogens.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23783033 2013 ARF1 and ARF4 regulate recycling endosomal morphology and retrograde transport from endosomes to the Golgi apparatus.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
More...