Property Summary

NCBI Gene PubMed Count 113
PubMed Score 29.30
PubTator Score 40.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
astrocytoma 2.100 2.8e-03
Atopic dermatitis -1.100 2.0e-04
cutaneous lupus erythematosus -1.200 4.0e-03
diabetes mellitus -1.100 2.8e-03
glioblastoma 1.300 1.1e-02
group 3 medulloblastoma -1.400 1.5e-02
invasive ductal carcinoma -1.200 2.0e-02
lung carcinoma -1.100 7.4e-07
medulloblastoma, large-cell -1.100 4.5e-05
mucosa-associated lymphoid tissue lympho... 2.211 1.5e-02
osteosarcoma -2.126 1.1e-03
ovarian cancer -1.600 7.1e-08
pancreatic cancer 1.100 9.4e-04
pancreatic carcinoma 1.100 9.4e-04
posterior fossa group B ependymoma 1.100 5.7e-06
primary pancreatic ductal adenocarcinoma 1.067 6.2e-03
psoriasis -1.100 4.3e-06

Protein-protein Interaction (1)

Gene RIF (72)

AA Sequence

MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANL      1 - 70
VKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDL     71 - 140
YYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPN    141 - 210
CVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDV    211 - 280
PHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTA    281 - 350
LIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD    351 - 420
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS    421 - 490
PGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKG    491 - 560
VLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPT    561 - 630
CPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELP    631 - 700
SGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMAS    701 - 770
NPLYRKPISTHTVDFTFNKFNKSYNGTVD                                             771 - 799
//

Text Mined References (115)

PMID Year Title