Property Summary

NCBI Gene PubMed Count 111
PubMed Score 27.11
PubTator Score 40.76

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
pancreatic cancer 1.600 0.001
psoriasis -1.600 0.000
cutaneous lupus erythematosus -1.200 0.004
osteosarcoma -2.126 0.001
astrocytoma 2.100 0.003
glioblastoma 1.300 0.011
medulloblastoma, large-cell -1.400 0.000
Atopic dermatitis -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.586 0.001
diabetes mellitus -1.100 0.003
group 3 medulloblastoma -1.400 0.015
posterior fossa group B ependymoma 1.100 0.000
pancreatic carcinoma 1.100 0.001
lung carcinoma -1.100 0.000
mucosa-associated lymphoid tissue lympho... 2.211 0.015
invasive ductal carcinoma -1.200 0.020
ovarian cancer 2.200 0.000

Synonym

Accession P18084 B0LPF8 B2RD70
Symbols

Gene

 GO Function (1)

Gene RIF (71)

PMID Text
26244551 Data suggest that the binding, but not the internalization of photoreceptor outer segments (POS) confers protective effects on retinal pigment epithelium (RPE) cells through the alphavbeta5 integrin/focal adhesion kinase (FAK)/PGC-1alpha pathway.
25472585 ITGA3, ITGA6, ITGB3,ITGB4 and ITGB5 are associated with GC susceptibility (rs2675), ITGA3, ITGA6, ITGB3, ITGB4 and ITGB5 are associated with gastric cancer susceptibility tumor stage and lymphatic metastasis in Chinese Han population
25448675 FRMD5 regulates tumor cell motility via a dual pathway involving FRMD5 binding to integrin beta5 tail and to ROCK1
25150423 Immunohistochemical analysis for alphavbeta3, alphavbeta5 and alphavbeta6 integrin subunits was performed and correlated with Ki67 and hypoxia-inducible factor (HIF)-1alpha indexes
24997346 Myo7a interacts with integrin beta5 and selectively promotes integrin alphavbeta5-mediated cell migration
24899686 FAK activity regulates beta5 integrin expression and anchorage-independent cell growth in ovarian carcinoma.
24639195 Integrins alphavbeta5 and alphavbeta3 both control myofibroblast differentiation by activating latent TGF-beta1
24455718 we demonstrated via antibody blocking experiments that aV b5 and a6 significantly promoted hESC attachment in 2%oxygen only, whereas blockage of CD44 inhibited cell attachment in 21% O2 alone
24389192 findings suggest that Alpha(v)Beta5 integrins and their natural ligand VN are involved in P. fluorescens adherence and invasion in human epithelial cells
24294359 Brain metastases ITGB5 expression exhibits considerable heterogeneity according to tumor origin.
More...

AA Sequence

MPRAPAPLYACLLGLCALLPRLAGLNICTSGSATSCEECLLIHPKCAWCSKEDFGSPRSITSRCDLRANL      1 - 70
VKNGCGGEIESPASSFHVLRSLPLSSKGSGSAGWDVIQMTPQEIAVNLRPGDKTTFQLQVRQVEDYPVDL     71 - 140
YYLMDLSLSMKDDLDNIRSLGTKLAEEMRKLTSNFRLGFGSFVDKDISPFSYTAPRYQTNPCIGYKLFPN    141 - 210
CVPSFGFRHLLPLTDRVDSFNEEVRKQRVSRNRDAPEGGFDAVLQAAVCKEKIGWRKDALHLLVFTTDDV    211 - 280
PHIALDGKLGGLVQPHDGQCHLNEANEYTASNQMDYPSLALLGEKLAENNINLIFAVTKNHYMLYKNFTA    281 - 350
LIPGTTVEILDGDSKNIIQLIINAYNSIRSKVELSVWDQPEDLNLFFTATCQDGVSYPGQRKCEGLKIGD    351 - 420
TASFEVSLEARSCPSRHTEHVFALRPVGFRDSLEVGVTYNCTCGCSVGLEPNSARCNGSGTYVCGLCECS    421 - 490
PGYLGTRCECQDGENQSVYQNLCREAEGKPLCSGRGDCSCNQCSCFESEFGKIYGPFCECDNFSCARNKG    491 - 560
VLCSGHGECHCGECKCHAGYIGDNCNCSTDISTCRGRDGQICSERGHCLCGQCQCTEPGAFGEMCEKCPT    561 - 630
CPDACSTKRDCVECLLLHSGKPDNQTCHSLCRDEVITWVDTIVKDDQEAVLCFYKTAKDCVMMFTYVELP    631 - 700
SGKSNLTVLREPECGNTPNAMTILLAVVGSILLVGLALLAIWKLLVTIHDRREFAKFQSERSRARYEMAS    701 - 770
NPLYRKPISTHTVDFTFNKFNKSYNGTVD                                             771 - 799
//

Text Mined References (113)

PMID Year Title
26244551 2015 ?v?5 Integrin/FAK/PGC-1? Pathway Confers Protective Effects on Retinal Pigment Epithelium.
25472585 2015 Association between polymorphisms of microRNA-binding sites in integrin genes and gastric cancer in Chinese Han population.
25448675 2014 FERM domain-containing protein FRMD5 regulates cell motility via binding to integrin ?5 subunit and ROCK1.
25150423 2014 ?v?3, ?v?5 and ?v?6 integrins in brain metastases of lung cancer.
25063885 2014 KSHV attachment and entry are dependent on ?V?3 integrin localized to specific cell surface microdomains and do not correlate with the presence of heparan sulfate.
24997346 2014 FERM domain-containing unconventional myosin VIIA interacts with integrin ?5 subunit and regulates ?v?5-mediated cell adhesion and migration.
24899686 2014 FAK Inhibition disrupts a ?5 integrin signaling axis controlling anchorage-independent ovarian carcinoma growth.
24639195 2014 Integrins ?v?5 and ?v?3 promote latent TGF-?1 activation by human cardiac fibroblast contraction.
24455718 2013 ?V ?5 and CD44 are oxygen-regulated human embryonic stem cell attachment factors.
24389192 2014 Alpha(v)beta5 integrins mediates Pseudomonas fluorescens interaction with A549 cells.
More...