Property Summary

NCBI Gene PubMed Count 33
PubMed Score 18.90
PubTator Score 13.15

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Gene RIF (10)

AA Sequence

MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVI      1 - 70
WGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI                                   71 - 110
//

Text Mined References (37)

PMID Year Title