Property Summary

NCBI Gene PubMed Count 32
Grant Count 6
Funding $671,625
PubMed Score 17.41
PubTator Score 13.15

Knowledge Summary

Patent

No data available

Expression

Gene RIF (9)

PMID Text
23166591 Expression of HIV-1 Tat downregulates the abundance of ribosomal protein L35a (RPL35A) in the nucleoli of Jurkat T-cells
22262766 Data show 1 proband with an RPL5 deletion, 1 patient with an RPL35A deletion, 3 with RPS17 deletions, and 1 with an RPS19 deletion.
22174317 Expression of HIV-1 Tat downregulates the abundance of ribosomal protein L35a (RPL35A) in the nucleoli of Jurkat T-cells
22045982 Studies identified deletions at known Diamond-Blackfan anemia (DBA)-related ribosomal protein gene loci in 17% (9 of 51) of patients without an identifiable mutation, including RPS19, RPS17, RPS26, and RPL35A.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20378560 Observational study of gene-disease association. (HuGE Navigator)
19773262 Observational study of gene-disease association. (HuGE Navigator)
18535205 analysis of 2 Diamond-Blackfan anemia (DBA) patients with chromosome 3q deletions identified RPL35A as a potential DBA gene
12175552 Inhibition of cell death by ribosomal protein L35a.

AA Sequence

MSGRLWSKAIFAGYKRGLRNQREHTALLKIEGVYARDETEFYLGKRCAYVYKAKNNTVTPGGKPNKTRVI      1 - 70
WGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI                                   71 - 110
//

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22262766 2012 Extensive gene deletions in Japanese patients with Diamond-Blackfan anemia.
22045982 2011 Ribosomal protein gene deletions in Diamond-Blackfan anemia.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.
More...