Property Summary

NCBI Gene PubMed Count 32
PubMed Score 17.41
PubTator Score 13.15

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count
Anemia, Diamond-Blackfan 15
Disease Target Count P-value
sonic hedgehog group medulloblastoma 1482 9.38306017936839E-7
malignant mesothelioma 3163 1.35333652769387E-5
intraductal papillary-mucinous adenoma (IPMA) 2956 1.3126766283796E-4
osteosarcoma 7933 5.65770488798387E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 7.28074546190549E-4
Multiple myeloma 1328 0.00408660943212269
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.00640254672296928
ovarian cancer 8492 0.00915305855040435
Waldenstrons macroglobulinemia 765 0.0337903616376147
colon cancer 1475 0.0367843898902962
lung cancer 4473 0.0412317256324854
Disease Target Count Z-score Confidence
Anemia 252 4.128 2.1



Accession P18077 Q08ES9 Q9BVN7
Symbols DBA5



4UG0   4V6X   5AJ0  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
Fruitfly EggNOG Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

Gene RIF (9)

23166591 Expression of HIV-1 Tat downregulates the abundance of ribosomal protein L35a (RPL35A) in the nucleoli of Jurkat T-cells
22262766 Data show 1 proband with an RPL5 deletion, 1 patient with an RPL35A deletion, 3 with RPS17 deletions, and 1 with an RPS19 deletion.
22174317 Expression of HIV-1 Tat downregulates the abundance of ribosomal protein L35a (RPL35A) in the nucleoli of Jurkat T-cells
22045982 Studies identified deletions at known Diamond-Blackfan anemia (DBA)-related ribosomal protein gene loci in 17% (9 of 51) of patients without an identifiable mutation, including RPS19, RPS17, RPS26, and RPL35A.
20877624 Observational study of gene-disease association. (HuGE Navigator)
20378560 Observational study of gene-disease association. (HuGE Navigator)
19773262 Observational study of gene-disease association. (HuGE Navigator)
18535205 analysis of 2 Diamond-Blackfan anemia (DBA) patients with chromosome 3q deletions identified RPL35A as a potential DBA gene
12175552 Inhibition of cell death by ribosomal protein L35a.

AA Sequence

WGKVTRAHGNSGMVRAKFRSNLPAKAIGHRIRVMLYPSRI                                   71 - 110

Text Mined References (35)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24965446 2014 Host factors that interact with the pestivirus N-terminal protease, Npro, are components of the ribonucleoprotein complex.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22262766 2012 Extensive gene deletions in Japanese patients with Diamond-Blackfan anemia.
22045982 2011 Ribosomal protein gene deletions in Diamond-Blackfan anemia.
21269460 2011 Initial characterization of the human central proteome.
20877624 2010 Genetic variants in nuclear-encoded mitochondrial genes influence AIDS progression.