Property Summary

NCBI Gene PubMed Count 223
Grant Count 414
R01 Count 242
Funding $44,451,750.53
PubMed Score 1431.02
PubTator Score 822.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 0.000
oligodendroglioma 1.700 0.002
esophageal adenocarcinoma -1.400 0.020
psoriasis -2.200 0.000
cutaneous lupus erythematosus -1.500 0.002
glioblastoma 1.500 0.001
osteosarcoma 2.158 0.016
sonic hedgehog group medulloblastoma -1.700 0.019
atypical teratoid / rhabdoid tumor 2.400 0.005
non-small cell lung cancer 2.227 0.000
lung cancer 3.800 0.000
interstitial cystitis -1.200 0.002
pilocytic astrocytoma 1.700 0.000
ovarian cancer -1.200 0.000

Synonym

Accession P18075 Q9H512 Q9NTQ7 BMP-7
Symbols OP-1

Gene

PANTHER Protein Class (2)

PDB

1BMP   1LX5   1LXI   1M4U  

Gene RIF (186)

PMID Text
26824865 Adenovirus-mediated FoxC2 expression enhances BMP7-facilitated anabolism in nucleus pulposus cells of the intervertebral discs.
26695677 Transfection of HOXA13 in HKCs could inhibit the degree of EMT induced by albumin-overload, possibly by increasing BMP-7 expression.
26617798 miR-137/BMP7 axis could contribute to the progression of non-small cell lung cancer.
26503415 Inhibition of BMP7 expression mediated by KDM5C promotes neoplasm invasion in hepatocellular carcinoma cells.
26466853 Heterodimeric BMP-2/7 significantly promoted osteogenesis of human adipose-derived stem cells in vitro and in vivo. However, BMP-2/7 was not found to be a stronger inducer of osteogenesis compared to homodimeric either BMP-2 or BMP-7.
26417691 ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7.
26385023 the role of BMP-7 and its downstream signals in the neuroprotective effects of oxygen-glucose deprivation preconditioning
26304754 BMP4, BMP7 and receptors are expressed and active in the human fetal leptomeninges.
26112332 MiR-22 promotes the development of liver cirrhosis through BMP7 suppression.
25716319 hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype
More...

AA Sequence

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRP      1 - 70
HLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLV     71 - 140
EHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFL    141 - 210
LDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAF    211 - 280
FKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA    281 - 350
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY    351 - 420
RNMVVRACGCH                                                               421 - 431
//

Text Mined References (223)

PMID Year Title
26824865 2016 FoxC2 Enhances BMP7-Mediated Anabolism in Nucleus Pulposus Cells of the Intervertebral Disc.
26695677 2015 [Effect of Homeobox A13 transfection on epithelial-mesenchymal transition and bone morphogenetic protein-7 expression in kidney tubular epithelial cells].
26617798 2015 MicroRNA-137 inhibits cell migration and invasion by targeting bone morphogenetic protein-7 (BMP7) in non-small cell lung cancer cells.
26503415 2015 Lysine-specific demethylase 5C promotes hepatocellular carcinoma cell invasion through inhibition BMP7 expression.
26466853 2015 Effects of heterodimeric bone morphogenetic protein-2/7 on osteogenesis of human adipose-derived stem cells.
26417691 2015 Angiopoietin-like 4 enhances metastasis and inhibits apoptosis via inducing bone morphogenetic protein 7 in colorectal cancer cells.
26385023 2016 Oxygen-glucose deprivation preconditioning protects neurons against oxygen-glucose deprivation/reperfusion induced injury via bone morphogenetic protein-7 mediated ERK, p38 and Smad signalling pathways.
26304754 2015 Bone morphogenetic protein-4 and 7 and receptors regulate vascular endothelial growth factor and receptors in human fetal leptomeninges.
26112332 2015 MiR-22 Suppresses BMP7 in the Development of Cirrhosis.
25716319 2015 Hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype.
More...