Property Summary

NCBI Gene PubMed Count 235
PubMed Score 1536.82
PubTator Score 822.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
Astrocytoma, Pilocytic 1.500 1.8e-06
atypical teratoid / rhabdoid tumor 2.400 5.0e-03
cutaneous lupus erythematosus -1.500 2.0e-03
ependymoma 1.800 4.1e-02
esophageal adenocarcinoma -1.100 2.0e-02
glioblastoma 1.500 1.4e-03
group 4 medulloblastoma -1.400 7.0e-03
interstitial cystitis -1.200 2.4e-03
lung cancer 2.500 1.1e-05
non-small cell lung cancer 2.227 1.6e-09
oligodendroglioma 1.300 5.1e-03
osteosarcoma 2.158 1.6e-02
ovarian cancer 1.100 2.0e-02
psoriasis 1.200 5.2e-06

Protein-protein Interaction (9)

Gene RIF (197)

AA Sequence

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRP      1 - 70
HLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLV     71 - 140
EHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFL    141 - 210
LDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAF    211 - 280
FKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA    281 - 350
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY    351 - 420
RNMVVRACGCH                                                               421 - 431
//

Text Mined References (235)

PMID Year Title