Property Summary

NCBI Gene PubMed Count 223
PubMed Score 1431.02
PubTator Score 822.40

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
posterior fossa group B ependymoma 2.000 0.000
oligodendroglioma 1.700 0.002
esophageal adenocarcinoma -1.400 0.020
psoriasis -2.200 0.000
cutaneous lupus erythematosus -1.500 0.002
glioblastoma 1.500 0.001
osteosarcoma 2.158 0.016
sonic hedgehog group medulloblastoma -1.700 0.019
atypical teratoid / rhabdoid tumor 2.400 0.005
non-small cell lung cancer 2.227 0.000
lung cancer 3.800 0.000
interstitial cystitis -1.200 0.002
pilocytic astrocytoma 1.700 0.000
ovarian cancer -1.200 0.000

Synonym

Accession P18075 Q9H512 Q9NTQ7 BMP-7
Symbols OP-1

Gene

PANTHER Protein Class (2)

PDB

1BMP   1LX5   1LXI   1M4U  

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

Gene RIF (185)

PMID Text
26824865 Adenovirus-mediated FoxC2 expression enhances BMP7-facilitated anabolism in nucleus pulposus cells of the intervertebral discs.
26695677 Transfection of HOXA13 in HKCs could inhibit the degree of EMT induced by albumin-overload, possibly by increasing BMP-7 expression.
26617798 miR-137/BMP7 axis could contribute to the progression of non-small cell lung cancer.
26503415 Inhibition of BMP7 expression mediated by KDM5C promotes neoplasm invasion in hepatocellular carcinoma cells.
26466853 Heterodimeric BMP-2/7 significantly promoted osteogenesis of human adipose-derived stem cells in vitro and in vivo. However, BMP-2/7 was not found to be a stronger inducer of osteogenesis compared to homodimeric either BMP-2 or BMP-7.
26417691 ANGPTL4 might promote metastasis and might inhibit apoptosis of colorectal cancer cells by up-regulation of BMP7.
26385023 the role of BMP-7 and its downstream signals in the neuroprotective effects of oxygen-glucose deprivation preconditioning
26304754 BMP4, BMP7 and receptors are expressed and active in the human fetal leptomeninges.
26112332 MiR-22 promotes the development of liver cirrhosis through BMP7 suppression.
25716319 hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype
More...

AA Sequence

MHVRSLRAAAPHSFVALWAPLFLLRSALADFSLDNEVHSSFIHRRLRSQERREMQREILSILGLPHRPRP      1 - 70
HLQGKHNSAPMFMLDLYNAMAVEEGGGPGGQGFSYPYKAVFSTQGPPLASLQDSHFLTDADMVMSFVNLV     71 - 140
EHDKEFFHPRYHHREFRFDLSKIPEGEAVTAAEFRIYKDYIRERFDNETFRISVYQVLQEHLGRESDLFL    141 - 210
LDSRTLWASEEGWLVFDITATSNHWVVNPRHNLGLQLSVETLDGQSINPKLAGLIGRHGPQNKQPFMVAF    211 - 280
FKATEVHFRSIRSTGSKQRSQNRSKTPKNQEALRMANVAENSSSDQRQACKKHELYVSFRDLGWQDWIIA    281 - 350
PEGYAAYYCEGECAFPLNSYMNATNHAIVQTLVHFINPETVPKPCCAPTQLNAISVLYFDDSSNVILKKY    351 - 420
RNMVVRACGCH                                                               421 - 431
//

Text Mined References (223)

PMID Year Title
26824865 2016 FoxC2 Enhances BMP7-Mediated Anabolism in Nucleus Pulposus Cells of the Intervertebral Disc.
26695677 2015 [Effect of Homeobox A13 transfection on epithelial-mesenchymal transition and bone morphogenetic protein-7 expression in kidney tubular epithelial cells].
26617798 2015 MicroRNA-137 inhibits cell migration and invasion by targeting bone morphogenetic protein-7 (BMP7) in non-small cell lung cancer cells.
26503415 2015 Lysine-specific demethylase 5C promotes hepatocellular carcinoma cell invasion through inhibition BMP7 expression.
26466853 2015 Effects of heterodimeric bone morphogenetic protein-2/7 on osteogenesis of human adipose-derived stem cells.
26417691 2015 Angiopoietin-like 4 enhances metastasis and inhibits apoptosis via inducing bone morphogenetic protein 7 in colorectal cancer cells.
26385023 2016 Oxygen-glucose deprivation preconditioning protects neurons against oxygen-glucose deprivation/reperfusion induced injury via bone morphogenetic protein-7 mediated ERK, p38 and Smad signalling pathways.
26304754 2015 Bone morphogenetic protein-4 and 7 and receptors regulate vascular endothelial growth factor and receptors in human fetal leptomeninges.
26112332 2015 MiR-22 Suppresses BMP7 in the Development of Cirrhosis.
25716319 2015 Hyaluronan regulates bone morphogenetic protein-7-dependent prevention and reversal of myofibroblast phenotype.
More...