Property Summary

NCBI Gene PubMed Count 734
Grant Count 227
R01 Count 138
Funding $26,094,125.96
PubMed Score 849.48
PubTator Score 889.94

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18074 Q2TB78 Q2YDY2 Q7KZU6 Q8N721
Symbols EM9
TTD
XPD
TTD1
COFS2
TFIIH

Gene

PDB

5IY6   5IY7   5IY8   5IY9   5IVW  

Gene RIF (802)

PMID Text
27166553 XPD SNPs are not associated with acute coronary syndromes in patients from Pakistan.
27069143 There exists no obvious contribution of XPD genotypes to tumor size.
26898429 The aim of this study was to investigate the association between polymorphisms of XRCC1 Arg399Gln, XRCC3 Thr241Met, and XPD Lys751Gln and laryngeal cancer risk.
26823845 ERCC1 rs11615 and rs3212986 and ERCC2 rs13181 and rs1799793 polymorphisms were genotyped using the polymerase chain reaction restriction fragment length polymorphism
26782397 In conclusion, our study suggests that ERCC2 rs1799793 polymorphic variation could be used as a predictor for the prognosis of gastric cancer
26722489 Lys751Gln polymorphism of XPD gene can be used as one susceptibility factor for hepatocellular carcinoma
26649138 The frequency of the XPD 312Asn allele was significantly higher in T >/= 2 high grade than in T >/= 2 low grade tumors (p = 0.036); the ERCC6 1097Val/Val genotype was strongly associated with muscle-invasive tumors.
26627042 The minor allele of rs13181 polymorphism may confer a protect effect against radiotoxicity
26505449 study found that the ERCC2 Asn312Asp gene polymorphism likely plays an important role in influencing the chemotherapy response and overall survival of patients with osteosarcoma.
26505408 We aimed to conduct a meta-analysis to investigate the role of ERCC2 rs13181 on the risk of glioma
More...

AA Sequence

MKLNVDGLLVYFPYDYIYPEQFSYMRELKRTLDAKGHGVLEMPSGTGKTVSLLALIMAYQRAYPLEVTKL      1 - 70
IYCSRTVPEIEKVIEELRKLLNFYEKQEGEKLPFLGLALSSRKNLCIHPEVTPLRFGKDVDGKCHSLTAS     71 - 140
YVRAQYQHDTSLPHCRFYEEFDAHGREVPLPAGIYNLDDLKALGRRQGWCPYFLARYSILHANVVVYSYH    141 - 210
YLLDPKIADLVSKELARKAVVVFDEAHNIDNVCIDSMSVNLTRRTLDRCQGNLETLQKTVLRIKETDEQR    211 - 280
LRDEYRRLVEGLREASAARETDAHLANPVLPDEVLQEAVPGSIRTAEHFLGFLRRLLEYVKWRLRVQHVV    281 - 350
QESPPAFLSGLAQRVCIQRKPLRFCAERLRSLLHTLEITDLADFSPLTLLANFATLVSTYAKGFTIIIEP    351 - 420
FDDRTPTIANPILHFSCMDASLAIKPVFERFQSVIITSGTLSPLDIYPKILDFHPVTMATFTMTLARVCL    421 - 490
CPMIIGRGNDQVAISSKFETREDIAVIRNYGNLLLEMSAVVPDGIVAFFTSYQYMESTVASWYEQGILEN    491 - 560
IQRNKLLFIETQDGAETSVALEKYQEACENGRGAILLSVARGKVSEGIDFVHHYGRAVIMFGVPYVYTQS    561 - 630
RILKARLEYLRDQFQIRENDFLTFDAMRHAAQCVGRAIRGKTDYGLMVFADKRFARGDKRGKLPRWIQEH    631 - 700
LTDANLNLTVDEGVQVAKYFLRQMAQPFHREDQLGLSLLSLEQLESEETLKRIEQIAQQL              701 - 760
//

Text Mined References (739)

PMID Year Title
27193682 2016 Near-atomic resolution visualization of human transcription promoter opening.
27166553 2016 Association of Polymorphisms (rs 1799782, rs25489 and rs25487) in XRCC1 and (rs 13181) XPD genes with Acute Coronary Artery Syndrome in Subjects from Multan, Pakistan.
27069143 2016 Contribution of DNA Repair Xeroderma Pigmentosum Group D Genotypes to Colorectal Cancer Risk in Taiwan.
26898429 2016 Single nucleotide polymorphisms in DNA repair genes and the risk of laryngeal cancer: A meta-analysis.
26823845 2015 Prognostic value of ERCC1 and ERCC2 gene polymorphisms in patients with gastric cancer receiving platinum-based chemotherapy.
26782397 2015 Genetic variability of ERCC1 and ERCC2 influences treatment outcomes in gastric cancer.
26722489 2015 A meta-analysis of xeroderma pigmentosum gene D Ls751Gln polymorphism and susceptibility to hepatocellular carcinoma.
26649138 2016 The Cellular Response to Oxidatively Induced DNA Damage and Polymorphism of Some DNA Repair Genes Associated with Clinicopathological Features of Bladder Cancer.
26627042 2015 ERCC2 polymorphisms and radiation-induced adverse effects on normal tissue: systematic review with meta-analysis and trial sequential analysis.
26505449 2015 Influence of ERCC2 gene polymorphisms on the treatment outcome of osteosarcoma.
More...