Property Summary

NCBI Gene PubMed Count 197
Grant Count 145
R01 Count 110
Funding $10,515,325.61
PubMed Score 814.83
PubTator Score 462.75

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P18065 Q14619 Q9UCL3 IBP-2
Symbols IBP2
IGF-BP53

Gene

PDB

2H7T  

Gene RIF (160)

PMID Text
26616478 Serum IGFBP2 reflects disease activity and renal pathology changes in lupus nephritis.
26559475 Insulin-like growth factor binding protein 2 is strongly associated with restoration of keratocyte phenotype in HCFs.
26317790 Data show that modulation of insulin like growth factor binding protein 2 (IGFBP2) expression affects proliferation, motility, and chemosensitization of eophageal adenocarcinoma (EAC) cells in a serum-dependent manner.
26094770 These results implicate TRIB3 and IGFBP2, both of which are known to be overexpressed in several types of cancers, as pro-survival modulators of cell viability in nutrient-deficient microenvironments.
26080829 The expression levels of maspin were lower in the cisplatin-resistant tissue and cells, and was enhanced by IGFBP-2 inhibition.
26076738 IGFBP-2 overexpression in HUVECs promoted endothelial progenitor cells(EPC)-endothelial adhesion. The RGD motif in its C-domain is required for interaction with integrin alpha5beta1.
26068014 Serum IGFBP2 was increased in patients with hepatocellular carcinoma compared to healthy controls, but lower than in patients with liver cirrhosis.
26043140 that age-specific cognitive decline may be moderated by IGF-BP2
25900123 Elevated serum IGFBP2 levels might play a role in the postnatal growth retardation phenotype of Pallister-Killian syndrome.
25893308 Identification of a novel tumor-promoting function for IGFBP2 of activating EGFR/STAT3 signaling and facilitating EGFR accumulation in the nucleus, thereby deregulating EGFR signaling by two distinct mechanisms.
More...

AA Sequence

MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAVAGG      1 - 70
ARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYG     71 - 140
ASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHL    141 - 210
GLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQR    211 - 280
GECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ                             281 - 325
//

Text Mined References (199)

PMID Year Title
26616478 2016 Insulin-like growth factor binding protein-2 as a novel biomarker for disease activity and renal pathology changes in lupus nephritis.
26559475 2015 The Role of Insulin-Like Growth Factor Binding Protein 2 (IGFBP2) in the Regulation of Corneal Fibroblast Differentiation.
26317790 2015 IGFBP2 modulates the chemoresistant phenotype in esophageal adenocarcinoma.
26243351 2015 Relationship Between Insulin-Like Growth Factor Binding Protein-2 and Left Ventricular Stroke Volume in Patients With Aortic Stenosis.
26160960 2015 Comparison of Different Cytokine Conditions Reveals Resveratrol as a New Molecule for Ex Vivo Cultivation of Cord Blood-Derived Hematopoietic Stem Cells.
26107517 2015 HPV16 Down-Regulates the Insulin-Like Growth Factor Binding Protein 2 to Promote Epithelial Invasion in Organotypic Cultures.
26106415 2015 Serum IGFBP-2 and Risk of Atypical Hyperplasia of the Breast.
26097693 2015 Linking patient outcome to high throughput protein expression data identifies novel regulators of colorectal adenocarcinoma aggressiveness.
26094770 2015 TRIB3 enhances cell viability during glucose deprivation in HEK293-derived cells by upregulating IGFBP2, a novel nutrient deficiency survival factor.
26080829 2015 Inhibition of IGFBP-2 improves the sensitivity of bladder cancer cells to cisplatin via upregulating the expression of maspin.
More...