Property Summary

Ligand Count 2
NCBI Gene PubMed Count 211
PubMed Score 835.02
PubTator Score 462.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma 2.100 5.7e-03
astrocytoma 1.300 1.4e-03
Astrocytoma, Pilocytic 1.200 1.1e-02
atypical teratoid / rhabdoid tumor 2.100 1.1e-03
Breast cancer 2.600 3.3e-02
cystic fibrosis 2.300 8.4e-04
ependymoma 1.800 4.9e-05
fibroadenoma 1.900 2.6e-03
glioblastoma 3.100 7.9e-08
group 3 medulloblastoma 1.400 3.7e-02
interstitial cystitis -2.100 3.6e-03
intraductal papillary-mucinous adenoma (... -2.100 2.6e-03
intraductal papillary-mucinous carcinoma... -1.500 3.1e-02
lung adenocarcinoma 1.694 5.0e-03
malignant mesothelioma 1.500 2.4e-06
medulloblastoma, large-cell 2.000 7.1e-04
non-small cell lung cancer 2.564 1.0e-14
oligodendroglioma 1.500 1.5e-03
ovarian cancer 3.200 7.9e-07
pancreatic cancer -1.500 4.2e-03
permanent atrial fibrillation 1.400 6.1e-05
pituitary cancer -2.300 6.4e-07
primitive neuroectodermal tumor 2.200 2.5e-03
psoriasis -2.000 7.2e-05
ulcerative colitis 1.249 4.5e-02
urothelial carcinoma -2.100 4.1e-02

Gene RIF (174)

AA Sequence

MLPRVGCPALPLPPPPLLPLLLLLLGASGGGGGARAEVLFRCPPCTPERLAACGPPPVAPPAAVAAVAGG      1 - 70
ARMPCAELVREPGCGCCSVCARLEGEACGVYTPRCGQGLRCYPHPGSELPLQALVMGEGTCEKRRDAEYG     71 - 140
ASPEQVADNGDDHSEGGLVENHVDSTMNMLGGGGSAGRKPLKSGMKELAVFREKVTEQHRQMGKGGKHHL    141 - 210
GLEEPKKLRPPPARTPCQQELDQVLERISTMRLPDERGPLEHLYSLHIPNCDKHGLYNLKQCKMSLNGQR    211 - 280
GECWCVNPNTGKLIQGAPTIRGDPECHLFYNEQQEARGVHTQRMQ                             281 - 325
//

Text Mined References (213)

PMID Year Title