Property Summary

NCBI Gene PubMed Count 130
PubMed Score 108.46
PubTator Score 120.78

Knowledge Summary


No data available


  Disease Sources (5)

Disease Target Count
Actinic keratosis 22
Disease Target Count P-value
osteosarcoma 7933 1.28080697798456E-5
pancreatic carcinoma 567 0.00376213262956331
pancreatic cancer 2300 0.00376213262956336
esophageal adenocarcinoma 737 0.0195374477369276
cutaneous lupus erythematosus 1056 0.0229485169546861
Disease Target Count Z-score Confidence
Cancer 2346 3.495 1.7
Disease Target Count
Colorectal Cancer 62
Esophageal cancer 30


  Differential Expression (5)

Disease log2 FC p
pancreatic cancer 1.300 0.004
esophageal adenocarcinoma -3.300 0.020
cutaneous lupus erythematosus -1.600 0.023
osteosarcoma -2.489 0.000
pancreatic carcinoma 1.300 0.004


Accession P18054 O95569 Q6ISF8 Q9UQM4 12S-LOX
Symbols LOG12


PANTHER Protein Class (2)


2ABU   3D3L  

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA EggNOG
Opossum OMA EggNOG Inparanoid

MLP Assay (14)

AID Type Active / Inconclusive / Inactive Description
1452 confirmatory 187 / 2313 / 151107 qHTS Assay for Inhibitors of 12-hLO (12-human lipoxygenase)
2162 confirmatory 25 / 18 / 52 Confirmation qHTS Assay for Inhibitors of 12-hLO (12-human lipoxygenase)
2163 confirmatory 21 / 0 / 14 Cuvette-Based Assay for Inhibitors of 12-hLO (12-human lipoxygenase): 8HQ Series - Round 1
2164 summary 0 / 0 / 0 Probe Development Summary of Inhibitors of 12-hLO (12-human lipoxygenase)
2584 confirmatory 8 / 8 / 36 qHTS Assay for Inhibitors of 12-hLO (12-human lipoxygenase) - Confirmatory and Counterscreen Data
493209 confirmatory 6 / 0 / 54 Activators of 12-hLO (12-human lipoxygenase): 12hLO Cuvette-Based Hit Validation Assay of Followup Compounds
493216 confirmatory 54 / 0 / 0 Inhibitors of 12-hLO (12-human lipoxygenase): Cuvette-Based Hit Assay for Validation of Followup Compounds
504581 other 1 / 0 / 0 Inhibitors of 12-hLO: PBS Stability Profiling
504587 other 0 / 0 / 2 Inhibitors of HPGD: Efflux Ratio Profiling
504590 other 0 / 1 / 0 Inhibitors of 12-hLO: Aqueous Solubility Profiling

Gene RIF (114)

26672987 The regulation of important oxylipin metabolic genes in peripheral blood mononuclear cells varied with the extent of change in arachidonic acid concentrations in the case of PTGS1 and ALOX12 regulation.
26372769 Results identified a novel ALOX12 locus (indicated by two SNPs in perfect linkage disequilibrium: rs1042357 and rs10852889) that moderated the association between PTSD and reduced thickness of the right prefrontal cortex.
26106157 Results indicate that secreted phospholipase A2 IIA (sPLA2-IIA) as an enzyme working in concert with platelet microparticles (MPs) 12-lipoxygenase (12-LO) to promote internalization.
26037302 ITGB4 stimulation leads to recruitment of 12-LOX from the cytosol to the membrane.
25708815 The 12/15-lipoxygenase as an emerging therapeutic target for Alzheimer's disease
25598081 the amount of LPL expressed in muscle and heart governed both the binding of chylomicron particles and the assimilation of chylomicron lipids in the tissue.
25549319 IGF-1 reduces lipid oxidation and foam cell formation via downregulation of 12/15-LOX to prevent atherosclerosis.
25532042 The costaining of pancreatic polypeptide and vimentin suggests that 12-LO participates in the process leading to beta-cell dedifferentiation in the islet.
25339205 In the highest tertile with ALOX12.
25260086 Inhibition of 12-LOX activity significantly sensitizes prostate cancer cells to radiation.

AA Sequence

LEKLEKEITARNEQLDWPYEYLKPSCIENSVTI                                         631 - 663

Text Mined References (132)

PMID Year Title
26672987 2015 Changes in PTGS1 and ALOX12 Gene Expression in Peripheral Blood Mononuclear Cells Are Associated with Changes in Arachidonic Acid, Oxylipins, and Oxylipin/Fatty Acid Ratios in Response to Omega-3 Fatty Acid Supplementation.
26372769 2015 A novel locus in the oxidative stress-related gene ALOX12 moderates the association between PTSD and thickness of the prefrontal cortex.
26106157 2015 Platelet microparticles are internalized in neutrophils via the concerted activity of 12-lipoxygenase and secreted phospholipase A2-IIA.
26037302 2015 Convergence of eicosanoid and integrin biology: 12-lipoxygenase seeks a partner.
25708815 2015 The 12/15-lipoxygenase as an emerging therapeutic target for Alzheimer's disease.
25598081 2015 A lipidomic screen of hyperglycemia-treated HRECs links 12/15-Lipoxygenase to microvascular dysfunction during diabetic retinopathy via NADPH oxidase.
25549319 2015 Insulin-like growth factor I reduces lipid oxidation and foam cell formation via downregulation of 12/15-lipoxygenase.
25532042 2015 Expression pattern of 12-lipoxygenase in human islets with type 1 diabetes and type 2 diabetes.
25339205 2015 Associations between ALOX, COX, and CRP polymorphisms and breast cancer among Hispanic and non-Hispanic white women: The breast cancer health disparities study.
25260086 2014 [Selective 12-lipoxygenase inhibition potentiates the effect of radiation on human prostate cancer cells in vitro and in vivo].