Property Summary

Ligand Count 45
NCBI Gene PubMed Count 131
PubMed Score 223.80
PubTator Score 120.78

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
cutaneous lupus erythematosus -1.600 2.3e-02
esophageal adenocarcinoma -3.300 2.0e-02
osteosarcoma -2.489 1.3e-05
pancreatic cancer 1.300 3.8e-03
pancreatic carcinoma 1.300 3.8e-03

Gene RIF (115)

AA Sequence

MGRYRIRVATGAWLFSGSYNRVQLWLVGTRGEAELELQLRPARGEEEEFDHDVAEDLGLLQFVRLRKHHW      1 - 70
LVDDAWFCDRITVQGPGACAEVAFPCYRWVQGEDILSLPEGTARLPGDNALDMFQKHREKELKDRQQIYC     71 - 140
WATWKEGLPLTIAADRKDDLPPNMRFHEEKRLDFEWTLKAGALEMALKRVYTLLSSWNCLEDFDQIFWGQ    141 - 210
KSALAEKVRQCWQDDELFSYQFLNGANPMLLRRSTSLPSRLVLPSGMEELQAQLEKELQNGSLFEADFIL    211 - 280
LDGIPANVIRGEKQYLAAPLVMLKMEPNGKLQPMVIQIQPPNPSSPTPTLFLPSDPPLAWLLAKSWVRNS    281 - 350
DFQLHEIQYHLLNTHLVAEVIAVATMRCLPGLHPIFKFLIPHIRYTMEINTRARTQLISDGGIFDKAVST    351 - 420
GGGGHVQLLRRAAAQLTYCSLCPPDDLADRGLLGLPGALYAHDALRLWEIIARYVEGIVHLFYQRDDIVK    421 - 490
GDPELQAWCREITEVGLCQAQDRGFPVSFQSQSQLCHFLTMCVFTCTAQHAAINQGQLDWYAWVPNAPCT    491 - 560
MRMPPPTTKEDVTMATVMGSLPDVRQACLQMAISWHLSRRQPDMVPLGHHKEKYFSGPKPKAVLNQFRTD    561 - 630
LEKLEKEITARNEQLDWPYEYLKPSCIENSVTI                                         631 - 663
//

Text Mined References (133)

PMID Year Title