Property Summary

NCBI Gene PubMed Count 283
Grant Count 279
R01 Count 161
Funding $21,876,810.39
PubMed Score 1197.14
PubTator Score 863.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.300 0.003
ovarian cancer 1.200 0.000

Synonym

Accession P18031 Q5TGD8 Q9BQV9 Q9NQQ4
Symbols PTP1B

Gene

PDB

3ZMP   3ZMQ   4ZRT   1A5Y   1AAX   1BZC   1BZH   1BZJ   1C83   1C84   1C85   1C86   1C87   1C88   1ECV   1EEN   1EEO   1G1F   1G1G   1G1H   1G7F   1G7G   1GFY   1I57   1JF7   1KAK   1KAV   1L8G   1LQF   1NL9   1NNY   1NO6   1NWE   1NWL   1NZ7   1OEM   1OEO   1OES   1OET   1OEU   1OEV   1ONY   1ONZ   1PA1   1PH0   1PTT   1PTU   1PTV   1PTY   1PXH   1PYN   1Q1M   1Q6J   1Q6M   1Q6N   1Q6P   1Q6S   1Q6T   1QXK   1SUG   1T48   1T49   1T4J   1WAX   1XBO   2AZR   2B07   2B4S   2BGD   2BGE   2CM2   2CM3   2CM7   2CM8   2CMA   2CMB   2CMC   2CNE   2CNF   2CNG   2CNH   2CNI   2F6F   2F6T   2F6V   2F6W   2F6Y   2F6Z   2F70   2F71   2FJM   2FJN   2H4G   2H4K   2HB1   2HNP   2HNQ   2NT7   2NTA   2QBP   2QBQ   2QBR   2QBS   2VEU   2VEV   2VEW   2VEX   2VEY   2ZMM   2ZN7   3A5J   3A5K   3CWE   3D9C   3EAX   3EB1   3EU0   3I7Z   3I80   3QKP   3QKQ   3SME   3ZV2   4BJO   4I8N   4QAH   4QAP   4QBE   4QBW   4Y14  

Gene RIF (193)

PMID Text
27016479 PTP1B directly regulates STAT5 phosphorylation and its activation via the cAMP/PKA pathway downstream of the 5-HT7 receptor is involved in the suppression of beta-casein expression in MCF-12A cells
26840794 PTP1B dephosphorylates PITX1 to weaken its protein stability and the transcriptional activity for p120RasGAP gene expression
26721204 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcomes imatinib-resistance of K562 cells.
26402673 O-GlcNAcylation of PTP1B can influence insulin signal transduction by modulating its own phosphatase activity, which participates in the process of hepatic insulin resistance.
26337385 On EGF stimulation, complexes containing Mena and PTP1B are recruited to the EGFR, causing receptor dephosphorylation and leading to decreased motility responses.
26299811 the multiple roles of PTP1B in liver diseases will be presented, with respect to liver regeneration, drug-induced liver disease, non-alcoholic fatty liver disease (NAFLD) and hepatocellular carcinoma--{REVIEW}
26259828 our data indicate that by targeting PTP1B, miR-744 plays a feed-forward role in regulating type I IFN signaling pathway.
25897081 PTP1B inhibited BRK by dephosphorylating Tyr-342, but activated SRC by antagonizing PAG-dependent inhibition by CSK.
25796170 Fumosorinone increased glucose uptake and improved insulin resistance by down-regulating the expression of PTP1B and activating the insulin signaling pathway, suggesting that it may possess antidiabetic properties.
25668475 Data shows a relationship between the dephosphorylation rate of different factors in signaling pathways related to cell proliferation and PTP1B activation.
More...

AA Sequence

MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINAS      1 - 70
LIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNL     71 - 140
KLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGP    141 - 210
VVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKF    211 - 280
IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK    281 - 350
GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT    351 - 420
AGAYLCYRFLFNSNT                                                           421 - 435
//

Text Mined References (288)

PMID Year Title
27016479 2016 Serotonin suppresses ?-casein expression via PTP1B activation in human mammary epithelial cells.
26840794 2016 Protein tyrosine phosphatase 1B dephosphorylates PITX1 and regulates p120RasGAP in hepatocellular carcinoma.
26721204 2016 Blockade of the interaction between Bcr-Abl and PTB1B by small molecule SBF-1 to overcome imatinib-resistance of chronic myeloid leukemia cells.
26402673 2015 The Role of PTP1B O-GlcNAcylation in Hepatic Insulin Resistance.
26337385 2015 PTP1B-dependent regulation of receptor tyrosine kinase signaling by the actin-binding protein Mena.
26299811 2015 Protein tyrosine phosphatase 1B (PTP1B): A key regulator and therapeutic target in liver diseases.
26259828 2015 miR-744 enhances type I interferon signaling pathway by targeting PTP1B in primary human renal mesangial cells.
25897081 2015 Protein-tyrosine Phosphatase and Kinase Specificity in Regulation of SRC and Breast Tumor Kinase.
25796184 2015 PEA-15 facilitates EGFR dephosphorylation via ERK sequestration at increased ER-PM contacts in TNBC cells.
25796170 2015 Fumosorinone, a novel PTP1B inhibitor, activates insulin signaling in insulin-resistance HepG2 cells and shows anti-diabetic effect in diabetic KKAy mice.
More...