Property Summary

Ligand Count 665
NCBI Gene PubMed Count 303
PubMed Score 1308.14
PubTator Score 863.56

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
lung cancer -1.300 3.2e-03
ovarian cancer 1.200 2.9e-05

Synonym

Accession P18031 Q5TGD8 Q9BQV9 Q9NQQ4
Symbols PTP1B

Gene

PDB

3ZMP   3ZMQ   4ZRT   1A5Y   1AAX   1BZC   1BZH   1BZJ   1C83   1C84   1C85   1C86   1C87   1C88   1ECV   1EEN   1EEO   1G1F   1G1G   1G1H   1G7F   1G7G   1GFY   1I57   1JF7   1KAK   1KAV   1L8G   1LQF   1NL9   1NNY   1NO6   1NWE   1NWL   1NZ7   1OEM   1OEO   1OES   1OET   1OEU   1OEV   1ONY   1ONZ   1PA1   1PH0   1PTT   1PTU   1PTV   1PTY   1PXH   1PYN   1Q1M   1Q6J   1Q6M   1Q6N   1Q6P   1Q6S   1Q6T   1QXK   1SUG   1T48   1T49   1T4J   1WAX   1XBO   2AZR   2B07   2B4S   2BGD   2BGE   2CM2   2CM3   2CM7   2CM8   2CMA   2CMB   2CMC   2CNE   2CNF   2CNG   2CNH   2CNI   2F6F   2F6T   2F6V   2F6W   2F6Y   2F6Z   2F70   2F71   2FJM   2FJN   2H4G   2H4K   2HB1   2HNP   2HNQ   2NT7   2NTA   2QBP   2QBQ   2QBR   2QBS   2VEU   2VEV   2VEW   2VEX   2VEY   2ZMM   2ZN7   3A5J   3A5K   3CWE   3D9C   3EAX   3EB1   3EU0   3I7Z   3I80   3QKP   3QKQ   3SME   3ZV2   4BJO   4I8N   4QAH   4QAP   4QBE   4QBW   4Y14   5K9V   5K9W   5KA0   5KA1   5KA2   5KA3   5KA4   5KA7   5KA8   5KA9   5KAA   5KAB   5KAC   5KAD   5T19  

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Protein-protein Interaction (1)

Gene RIF (213)

AA Sequence

MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLHQEDNDYINAS      1 - 70
LIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLKCAQYWPQKEEKEMIFEDTNL     71 - 140
KLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWPDFGVPESPASFLNFLFKVRESGSLSPEHGP    141 - 210
VVVHCSAGIGRSGTFCLADTCLLLMDKRKDPSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKF    211 - 280
IMGDSSVQDQWKELSHEDLEPPPEHIPPPPRPPKRILEPHNGKCREFFPNHQWVKEETQEDKDCPIKEEK    281 - 350
GSPLNAAPYGIESMSQDTEVRSRVVGGSLRGAQAASPAKGEPSLPEKDEDHALSYWKPFLVNMCVATVLT    351 - 420
AGAYLCYRFLFNSNT                                                           421 - 435
//

Text Mined References (308)

PMID Year Title