Property Summary

NCBI Gene PubMed Count 72
PubMed Score 169.39
PubTator Score 95.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Prostatic Neoplasms 471
Disease Target Count P-value
pilocytic astrocytoma 3086 2.39219054042298E-8
malignant mesothelioma 3163 2.2027970771891E-7
osteosarcoma 7933 1.45972403942287E-6
atypical teratoid / rhabdoid tumor 4369 1.69682254563417E-5
pediatric high grade glioma 2712 7.72834765068544E-5
glioblastoma 5572 3.34979582417553E-4
ovarian cancer 8492 0.00926190087645679
astrocytic glioma 2241 0.0200899381677707
ependymoma 2514 0.0266527438889314
Disease Target Count Z-score Confidence
Huntington's disease 72 3.176 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
astrocytic glioma -1.800 0.020
ependymoma -1.900 0.027
osteosarcoma -2.054 0.000
atypical teratoid / rhabdoid tumor -1.100 0.000
glioblastoma -1.500 0.000
pediatric high grade glioma -1.300 0.000
pilocytic astrocytoma -1.400 0.000
ovarian cancer 1.200 0.009

Synonym

Accession P17987 E1P5B2 Q15556 Q5TCM3 TCP-1-alpha
Symbols CCT1
CCTa
D6S230E
CCT-alpha
TCP-1-alpha

Gene

PANTHER Protein Class (2)

  Ortholog (15)

Gene RIF (34)

PMID Text
26706127 Data suggest that biosynthesis and folding of leukemogenic fusion oncoprotein AML1-ETO/RUNX1-RUNX1T1 is facilitated by interaction with the chaperonin TRiC/CCT1/TCP1 and HSP70 (heat shock protein 70).
26556873 Result suggest the positive correlation between purinergic receptor P2X 7 (P2X7R) and T-complex protein 1 (TCP-1) in lymphoma patients.
25704758 A role for the TRiC subunits TCP1 and CCT2, and potentially the entire TRiC complex, in breast cancer.
25224486 Changes for CRMP2, TCP1epsilon, TPM2 and 14-3-3gamma were confirmed in experimental tumors and in a series of 28 human SI-NETs.
24862099 CCT8 might be an oncogene and participate in HCC cell proliferation.
24846140 identified 6 of the 8 components of the chaperonin-containing TCP-1 (CCT) complex bound to LOX-1 cytoplasmic domain
23125841 Tandem affinity purification and mass spectrometry analysis identify t-complex 1 (TCP1), HIV-1 Gag, Gag/Pol, gp120, and Nef incorporated into staufen1 RNP complexes isolated from HIV-1-expressing cells
22360420 A protein encoded by this locus was found to be differentially expressed in postmortem brains from patients with atypical frontotemporal lobar degeneration.
21098288 Data suggest that specific molecular mediators involved in glucocerebrosidase maturation and degradation, and abnormal interaction with TCP1 and c-Cbl, could be responsible for phenotypic variation among patients with the same genotypes.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
More...

AA Sequence

MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHP      1 - 70
AAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNT     71 - 140
DELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESML    141 - 210
ISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILA    211 - 280
TGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEE    281 - 350
VVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS    351 - 420
IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDL    421 - 490
SNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND        491 - 556
//

Text Mined References (86)

PMID Year Title
26706127 2016 Chaperonin TRiC/CCT Modulates the Folding and Activity of Leukemogenic Fusion Oncoprotein AML1-ETO.
26556873 2015 Silencing P2X7 receptor downregulates the expression of TCP-1 involved in lymphoma lymphatic metastasis.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25704758 2015 Two members of the TRiC chaperonin complex, CCT2 and TCP1 are essential for survival of breast cancer cells and are linked to driving oncogenes.
25467444 2014 Proteostatic control of telomerase function through TRiC-mediated folding of TCAB1.
25416956 2014 A proteome-scale map of the human interactome network.
25224486 2015 Mechanisms of local invasion in enteroendocrine tumors: identification of novel candidate cytoskeleton-associated proteins in an experimental mouse model by a proteomic approach and validation in human tumors.
24862099 2014 Chaperonin containing TCP1, subunit 8 (CCT8) is upregulated in hepatocellular carcinoma and promotes HCC proliferation.
24846140 2014 Chaperonin-containing TCP-1 complex directly binds to the cytoplasmic domain of the LOX-1 receptor.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...