Property Summary

NCBI Gene PubMed Count 72
PubMed Score 173.74
PubTator Score 95.92

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Prostatic Neoplasms 495 0.0 0.0
Disease Target Count
Schizophrenia 1160
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Dentin caries 5 3.215 1.6
Huntington's disease 76 3.114 1.6

Expression

  Differential Expression (9)

Disease log2 FC p
adult high grade glioma -1.200 2.6e-04
astrocytic glioma -1.400 1.2e-02
Astrocytoma, Pilocytic -1.400 4.7e-08
atypical teratoid / rhabdoid tumor -1.100 1.7e-05
ependymoma -1.600 1.8e-02
glioblastoma -1.500 3.3e-04
malignant mesothelioma 1.700 2.2e-07
osteosarcoma -2.054 1.5e-06
ovarian cancer 1.200 9.3e-03

Gene RIF (35)

AA Sequence

MEGPLSVFGDRSTGETIRSQNVMAAASIANIVKSSLGPVGLDKMLVDDIGDVTITNDGATILKLLEVEHP      1 - 70
AAKVLCELADLQDKEVGDGTTSVVIIAAELLKNADELVKQKIHPTSVISGYRLACKEAVRYINENLIVNT     71 - 140
DELGRDCLINAAKTSMSSKIIGINGDFFANMVVDAVLAIKYTDIRGQPRYPVNSVNILKAHGRSQMESML    141 - 210
ISGYALNCVVGSQGMPKRIVNAKIACLDFSLQKTKMKLGVQVVITDPEKLDQIRQRESDITKERIQKILA    211 - 280
TGANVILTTGGIDDMCLKYFVEAGAMAVRRVLKRDLKRIAKASGATILSTLANLEGEETFEAAMLGQAEE    281 - 350
VVQERICDDELILIKNTKARTSASIILRGANDFMCDEMERSLHDALCVVKRVLESKSVVPGGGAVEAALS    351 - 420
IYLENYATSMGSREQLAIAEFARSLLVIPNTLAVNAAQDSTDLVAKLRAFHNEAQVNPERKNLKWIGLDL    421 - 490
SNGKPRDNKQAGVFEPTIVKVKSLKFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHSGALND        491 - 556
//

Text Mined References (86)

PMID Year Title