Property Summary

NCBI Gene PubMed Count 69
PubMed Score 18.49
PubTator Score 20.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
HIV Infections 100
Disease Target Count P-value
Multiple myeloma 1328 0.00111437850903932
ovarian cancer 8492 0.00157583739173231
lung cancer 4473 0.00190568234329791
subependymal giant cell astrocytoma 2287 0.0485640877128743
Disease Target Count Z-score Confidence
Acquired metabolic disease 267 0.0 2.0

Expression

  Differential Expression (4)

Disease log2 FC p
Multiple myeloma 1.182 0.001
lung cancer 1.100 0.002
subependymal giant cell astrocytoma -1.255 0.049
ovarian cancer 1.300 0.002

Synonym

Accession P17980 B2R8V1 Q3B757 Q3B865 Q53HU5 Q6GPG8 Q6IBS1 Q96HD3
Symbols TBP1

Gene

PANTHER Protein Class (1)

PDB

5GJQ   5GJR   5L4G  

  Ortholog (14)

Gene RIF (42)

PMID Text
21991300 These data suggest the existence of a negative feedback loop involving Akt/PKB that might act as a sensor to modulate TBP-1 levels in proliferating cells.
19853614 19S ATPase S6b (S6'/TBP1) binds CIITApIV in an S6a-dependent fashion and has effects similar to S6a on CIITApIV histone acetylation.
19325002 findings suggest that a component of 19S regulatory particles directly binds AR and might participate in AR-mediated transcriptional activation in cooperation with TBPIP.
18854154 Knockdown of proteasome (prosome, macropain) 26S subunit, ATPase, 3 (PSMC3) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
17649721 Heplipin induced KG-1 cell apoptosis is related with Wntl3 and ATPase3.
17334400 The stabilization effect exerted by TBP-1 requires an intact N-terminal 39 amino acids in ARF and occurs independently from N-terminal ubiquitination of the protein.
15221960 In normal cells, unmodified S12 associates with the 26S proteasome, while modified S12-M does not.
14665636 Tat-binding protein-1 binds to human ARF tumor suppressor and has a role in control of cell proliferation
14614829 HIV-1 Vif binds to the cellular cytidine deaminase APOBEC3G and targets it for degradation through an interaction with the proteasome, thereby inhibiting APOBEC3G mediated restriction of HIV-1 replication
14610662 molecular modeling of DNA:TATA element binding protein (TBP) interactions after treatment with 2-Chloro-2'-deoxyadenosine
More...

AA Sequence

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMK      1 - 70
DKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLV     71 - 140
DAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKE    141 - 210
KFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAP    211 - 280
SIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDR    281 - 350
KIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY    351 - 420
MEGILEVQAKKKANLQYYA                                                       421 - 439
//

Text Mined References (79)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24255178 2013 Protein interaction network of the mammalian Hippo pathway reveals mechanisms of kinase-phosphatase interactions.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23022100 2012 Discovery and fine mapping of serum protein loci through transethnic meta-analysis.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21991300 2011 A regulatory mechanism involving TBP-1/Tat-Binding Protein 1 and Akt/PKB in the control of cell proliferation.
21630459 2011 Proteomic characterization of the human sperm nucleus.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...