Property Summary

NCBI Gene PubMed Count 69
PubMed Score 19.28
PubTator Score 20.37

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count Z-score Confidence
HIV Infections 102 0.0 0.0
Disease Target Count P-value
Multiple myeloma 1332 1.1e-03
ovarian cancer 8520 1.6e-03
lung cancer 4740 1.9e-03
subependymal giant cell astrocytoma 2287 4.9e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
Acquired metabolic disease 336 0.0 3.0

Expression

  Differential Expression (4)

Disease log2 FC p
lung cancer 1.100 1.9e-03
Multiple myeloma 1.182 1.1e-03
ovarian cancer 1.300 1.6e-03
subependymal giant cell astrocytoma -1.255 4.9e-02

Gene RIF (43)

AA Sequence

MNLLPNIESPVTRQEKMATVWDEAEQDGIGEEVLKMSTEEIIQRTRLLDSEIKIMKSEVLRVTHELQAMK      1 - 70
DKIKENSEKIKVNKTLPYLVSNVIELLDVDPNDQEEDGANIDLDSQRKGKCAVIKTSTRQTYFLPVIGLV     71 - 140
DAEKLKPGDLVGVNKDSYLILETLPTEYDSRVKAMEVDERPTEQYSDIGGLDKQIQELVEAIVLPMNHKE    141 - 210
KFENLGIQPPKGVLMYGPPGTGKTLLARACAAQTKATFLKLAGPQLVQMFIGDGAKLVRDAFALAKEKAP    211 - 280
SIIFIDELDAIGTKRFDSEKAGDREVQRTMLELLNQLDGFQPNTQVKVIAATNRVDILDPALLRSGRLDR    281 - 350
KIEFPMPNEEARARIMQIHSRKMNVSPDVNYEELARCTDDFNGAQCKAVCVEAGMIALRRGATELTHEDY    351 - 420
MEGILEVQAKKKANLQYYA                                                       421 - 439
//

Text Mined References (82)

PMID Year Title