Property Summary

NCBI Gene PubMed Count 553
Grant Count 865
R01 Count 477
Funding $83,694,654.4
PubMed Score 2061.01
PubTator Score 1335.07

Knowledge Summary

Patent (185,267)

TINX Plot

  Disease Relevance (60)

Disease Z-score Confidence
Hypertension 287 6.024 3.0
Cancer 2,346 5.877 2.9
Proteinuria 63 4.549 2.3
Diabetic Retinopathy 53 4.222 2.1
Age related macular degeneration 84 3.614 1.8
Retinopathy of prematurity 21 3.525 1.8
Keratitis 42 3.474 1.7
Breast cancer 3,094
Carcinoma 2,147 1.0
Carcinoma of thyroid 17
Cardiovascular system disease 194 1.0
Cerebral Hemorrhage 27
Coronary heart disease 59
Disease Progression 125
Drug-Induced Liver Injury 118
Follicular thyroid carcinoma 11
Gastrointestinal stromal tumor 61
Hamman-Rich syndrome 35
Hemangiosarcoma 18
Liver Cirrhosis 101
Liver cell carcinoma 15
Mammary Neoplasms 410
Melanoma 261
Neoplasm Metastasis 138
Osteochondrodysplasias 15
Pancreatic Neuroendocrine Tumor 45
Papillary thyroid carcinoma 37
Renal Cell Carcinoma 199
Sarcoma of soft tissue 11
Skin Neoplasms 49
Uremia 19
adrenocortical carcinoma 1,427
adult high grade glioma 2,148
astrocytic glioma 2,241
atypical teratoid / rhabdoid tumor 4,369
cystic fibrosis 1,665
glioblastoma 5,572
group 4 medulloblastoma 1,875
interstitial lung disease 291
intraductal papillary-mucinous adenoma (... 2,956 
intraductal papillary-mucinous carcinoma... 2,988 
intraductal papillary-mucinous neoplasm ... 3,289 
invasive ductal carcinoma 2,950
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
non-small cell lung carcinoma 413
osteosarcoma 7,933
ovarian cancer 8,484
pancreatic cancer 2,300
pituitary cancer 1,972
posterior fossa group B ependymoma 1,530
pre-eclampsia 67
primary pancreatic ductal adenocarcinoma 1,271
primitive neuroectodermal tumor 3,031
psoriasis 6,685
tuberculosis 1,557
ulcerative colitis 2,087
urothelial carcinoma 318

Expression

Synonym

Gene

PDB

1FLT   1QSV   1QSZ   1QTY   1RV6   2XAC   3HNG   4CKV   4CL7   5EX3  

  TechDev Info (1)

Michael McManus Genetic interaction screen

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (495)

PMID Text
26728997 Findings indicate that hnRNP D and arginine methylation play important roles in the regulation of Flt-1 mRNA alternative polyadenylation.
26699385 Elevated levels of sFlt-1 are associated with adverse outcomes in stable patients with heart failure.
26642248 soluble fms-like tyrosine kinase-1 and placental growth factor as biomarkers in patients with coronary artery disease
26627848 High expression of VEGFR1 is associated with astrocytomas.
26551737 VEGFR-1 activation-induced MMP-9-dependent invasion in hepatocellular carcinoma
26450920 Our results validate previous findings that suggest VEGFR1-positive cells in benign lymph nodes can predict clinical outcome
26434493 There is a significant negative correlation between the concentration of sFLt-1 and PlGF in normal pregnancy.
26416849 Data show that soluble fms-like tyrosine kinase-1 (sFLT-1) e15a isoform is increased in severe preeclampsia and is expressed in trophoblast.
26394830 High expression levels of VEGFR1 and VEGFR3 were associated with a higher rate of lung metastasis.
26261265 FLT1 inhibition reduces tumor metastatic efficiency even after initial seeding, suggesting that these pathways represent therapeutic targets in metastatic disease.
More...

AA Sequence

MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE      1 - 70
SERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYS     71 - 140
EIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEAT    141 - 210
VNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRR    211 - 280
RIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK    281 - 350
RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA    351 - 420
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESF    421 - 490
ILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNGFH    491 - 560
VNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQD    561 - 630
SGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHK    631 - 700
IQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAAT    701 - 770
LFWLLLTLFIRKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK    771 - 840
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVE    841 - 910
YCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDV    911 - 980
EEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN    981 - 1050
PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMR   1051 - 1120
APEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFS   1121 - 1190
EDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW   1191 - 1260
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPPDYNSV   1261 - 1330
VLYSTPPI                                                                 1331 - 1338
//

Text Mined References (569)

PMID Year Title
26728997 2016 Regulation of soluble Flt-1 (VEGFR-1) production by hnRNP D and protein arginine methylation.
26699385 2016 Elevated Soluble Fms-Like Tyrosine Kinase-1 and Placental-Like Growth Factor Levels Are Associated With Development and Mortality Risk in Heart Failure.
26642248 2016 Prognostic use of soluble fms-like tyrosine kinase-1 and placental growth factor in patients with coronary artery disease.
26627848 2016 Differential expression of vascular endothelial growth factor A, its receptors VEGFR-1, -2, and -3 and co-receptors neuropilin-1 and -2 does not predict bevacizumab response in human astrocytomas.
26551737 2015 VEGFR-1 activation-induced MMP-9-dependent invasion in hepatocellular carcinoma.
26450920 2015 Clinical and Translational Assessment of VEGFR1 as a Mediator of the Premetastatic Niche in High-Risk Localized Prostate Cancer.
26434493 2015 Difference of concentration of placental soluble fms-like tyrosine kinase-1(sFlt-1), placental growth factor (PlGF), and sFlt-1/PlGF ratio in severe preeclampsia and normal pregnancy.
26416849 2015 Placental-Specific sFLT-1 e15a Protein Is Increased in Preeclampsia, Antagonizes Vascular Endothelial Growth Factor Signaling, and Has Antiangiogenic Activity.
26394830 2015 Angiogenesis-related protein expression in bevacizumab-treated metastatic colorectal cancer: NOTCH1 detrimental to overall survival.
26261265 2015 FLT1 signaling in metastasis-associated macrophages activates an inflammatory signature that promotes breast cancer metastasis.
More...