Property Summary

Ligand Count 156
NCBI Gene PubMed Count 606
PubMed Score 2189.42
PubTator Score 1335.07

Knowledge Summary

Patent (185,267)

TINX Plot

  Disease (7)

Disease Target Count
Mammary Neoplasms 425
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.3
Kidney cancer 2613 0.0 0.8
Skin cancer 469 0.0 0.8
Disease Target Count Z-score Confidence
Cardiovascular system disease 246 0.0 1.9

Expression

  Differential Expression (28)

Disease log2 FC p
lung cancer -1.200 5.8e-03
Breast cancer 1.100 9.2e-07
adrenocortical carcinoma 1.101 2.8e-02
adult high grade glioma -1.500 2.2e-04
astrocytic glioma -1.100 6.5e-03
atypical teratoid / rhabdoid tumor -1.600 1.1e-04
cystic fibrosis -1.696 2.0e-04
glioblastoma -1.400 7.2e-04
group 4 medulloblastoma -2.000 5.0e-06
interstitial lung disease -1.300 7.7e-03
intraductal papillary-mucinous adenoma (... -1.700 8.3e-04
intraductal papillary-mucinous carcinoma... -1.600 6.5e-03
intraductal papillary-mucinous neoplasm ... -2.000 8.0e-03
invasive ductal carcinoma -1.100 2.1e-02
lung adenocarcinoma -1.200 3.4e-11
medulloblastoma, large-cell -2.200 1.6e-04
non-small cell lung carcinoma -1.200 3.4e-19
osteosarcoma 2.089 6.0e-05
ovarian cancer 1.300 7.7e-04
pancreatic cancer 1.500 1.5e-03
pituitary cancer -1.100 8.0e-03
posterior fossa group B ependymoma -1.200 6.9e-06
primary pancreatic ductal adenocarcinoma 1.845 2.9e-04
primitive neuroectodermal tumor -1.500 3.2e-03
psoriasis -1.300 8.2e-04
tuberculosis -1.700 2.9e-07
ulcerative colitis 1.200 2.4e-04
urothelial carcinoma 1.900 1.2e-06

 CSPA Cell Line (1)

Gene RIF (546)

AA Sequence

MVSYWDTGVLLCALLSCLLLTGSSSGSKLKDPELSLKGTQHIMQAGQTLHLQCRGEAAHKWSLPEMVSKE      1 - 70
SERLSITKSACGRNGKQFCSTLTLNTAQANHTGFYSCKYLAVPTSKKKETESAIYIFISDTGRPFVEMYS     71 - 140
EIPEIIHMTEGRELVIPCRVTSPNITVTLKKFPLDTLIPDGKRIIWDSRKGFIISNATYKEIGLLTCEAT    141 - 210
VNGHLYKTNYLTHRQTNTIIDVQISTPRPVKLLRGHTLVLNCTATTPLNTRVQMTWSYPDEKNKRASVRR    211 - 280
RIDQSNSHANIFYSVLTIDKMQNKDKGLYTCRVRSGPSFKSVNTSVHIYDKAFITVKHRKQQVLETVAGK    281 - 350
RSYRLSMKVKAFPSPEVVWLKDGLPATEKSARYLTRGYSLIIKDVTEEDAGNYTILLSIKQSNVFKNLTA    351 - 420
TLIVNVKPQIYEKAVSSFPDPALYPLGSRQILTCTAYGIPQPTIKWFWHPCNHNHSEARCDFCSNNEESF    421 - 490
ILDADSNMGNRIESITQRMAIIEGKNKMASTLVVADSRISGIYICIASNKVGTVGRNISFYITDVPNGFH    491 - 560
VNLEKMPTEGEDLKLSCTVNKFLYRDVTWILLRTVNNRTMHYSISKQKMAITKEHSITLNLTIMNVSLQD    561 - 630
SGTYACRARNVYTGEEILQKKEITIRDQEAPYLLRNLSDHTVAISSSTTLDCHANGVPEPQITWFKNNHK    631 - 700
IQQEPGIILGPGSSTLFIERVTEEDEGVYHCKATNQKGSVESSAYLTVQGTSDKSNLELITLTCTCVAAT    701 - 770
LFWLLLTLFIRKMKRSSSEIKTDYLSIIMDPDEVPLDEQCERLPYDASKWEFARERLKLGKSLGRGAFGK    771 - 840
VVQASAFGIKKSPTCRTVAVKMLKEGATASEYKALMTELKILTHIGHHLNVVNLLGACTKQGGPLMVIVE    841 - 910
YCKYGNLSNYLKSKRDLFFLNKDAALHMEPKKEKMEPGLEQGKKPRLDSVTSSESFASSGFQEDKSLSDV    911 - 980
EEEEDSDGFYKEPITMEDLISYSFQVARGMEFLSSRKCIHRDLAARNILLSENNVVKICDFGLARDIYKN    981 - 1050
PDYVRKGDTRLPLKWMAPESIFDKIYSTKSDVWSYGVLLWEIFSLGGSPYPGVQMDEDFCSRLREGMRMR   1051 - 1120
APEYSTPEIYQIMLDCWHRDPKERPRFAELVEKLGDLLQANVQQDGKDYIPINAILTGNSGFTYSTPAFS   1121 - 1190
EDFFKESISAPKFNSGSSDDVRYVNAFKFMSLERIKTFEELLPNATSMFDDYQGDSSTLLASPMLKRFTW   1191 - 1260
TDSKPKASLKIDLRVTSKSKESGLSDVSRPSFCHSSCGHVSEGKRRFTYDHAELERKIACCSPPPDYNSV   1261 - 1330
VLYSTPPI                                                                 1331 - 1338
//

Text Mined References (622)

PMID Year Title