Property Summary

NCBI Gene PubMed Count 168
Grant Count 474
R01 Count 318
Funding $73,115,811.76
PubMed Score 1091.99
PubTator Score 419.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
Rheumatoid Arthritis -2.100 0.011
psoriasis -1.600 0.000
osteosarcoma -1.758 0.010
non-small cell lung cancer -1.393 0.000
lung carcinoma -1.700 0.000

Synonym

Accession P17947
Symbols OF
PU.1
SFPI1
SPI-1
SPI-A

Gene

PANTHER Protein Class (1)

 GO Component (1)

Gene RIF (135)

PMID Text
27010793 The GATA-1-mediated inhibition of PU.1 gene transcription in human AML-erythroleukemias mediated through the URE represents important mechanism that contributes to PU.1 downregulation and leukemogenesis that is sensitive to DNA demethylation therapy
26942192 Our data suggest that E2A antagonism of PU.1 activity contributes to its ability to commit multipotential hematopoietic progenitors to the lymphoid lineages.
26851695 SPI1-GFI1B transcriptional network is an important regulatory axis in acute myeloid leukemia as well as in the development of erythroid versus myelomonocytic cell fate
26657848 Collectively, IMiDs exert demethylation activity through inhibiting DNMT1, 3a, and 3b, and up-regulating PU.1 expression, which may be one of the mechanisms of the anti-myeloma activity of IMiDs.
26429314 This study showed that HCV infection might abrogate NK cytotoxic potential through altering PU.1, NKG2D receptor and perforin molecules.
26261072 PU.1 downregulation was noted in B-CLL/SLL samples positive for the adverse prognostic markers CD38 and ZAP-70.
26149389 This study demonstrated positive regulation of monocyte/macrophage differentiation by lnc-MC and uncovered an elaborate regulation mechanism composed of PU.1, lnc-MC, miR-199a-5p, and ACVR1B.
26126967 PU.1 recruitment coupled with increased histone acetylation induces gene expression and activates a monocyte/macrophage transcriptional programme.
25987019 Loss of PU.1 expression is associated with Hepatocellular Carcinoma.
25205721 This review summarizes current knowledge and ideas of molecular mechanisms by which PU.1 controls hematopoiesis and suppresses leukemia. [review]
More...

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNF      1 - 70
TELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQS     71 - 140
PPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALA    141 - 210
HRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH              211 - 270
//

Publication (172)

PMID Year Title
27010793 2016 GATA-1 Inhibits PU.1 Gene via DNA and Histone H3K9 Methylation of Its Distal Enhancer in Erythroleukemia.
26942192 2016 E2A Antagonizes PU.1 Activity through Inhibition of DNA Binding.
26851695 2016 A somatic mutation of GFI1B identified in leukemia alters cell fate via a SPI1 (PU.1) centered genetic regulatory network.
26657848 2016 Immunomodulatory drugs act as inhibitors of DNA methyltransferases and induce PU.1 up-regulation in myeloma cells.
26429314 2015 Repressing PU.1 by miR-29a? in NK cells of HCV patients, diminishes its cytolytic effect on HCV infected cell models.
26261072 2015 Oncogenic microRNA-155 and its target PU.1: an integrative gene expression study in six of the most prevalent lymphomas.
26149389 2015 PU.1-Regulated Long Noncoding RNA lnc-MC Controls Human Monocyte/Macrophage Differentiation through Interaction with MicroRNA 199a-5p.
26126967 2016 Genome-scale definition of the transcriptional programme associated with compromised PU.1 activity in acute myeloid leukaemia.
25987019 2015 PU.1 Is Identified as a Novel Metastasis Suppressor in Hepatocellular Carcinoma Regulating the miR-615-5p/IGF2 Axis.
25205721 2014 Epigenetic control of hematopoiesis: the PU.1 chromatin connection.
More...