Property Summary

NCBI Gene PubMed Count 187
PubMed Score 1139.02
PubTator Score 419.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
lung carcinoma -1.700 9.8e-22
non-small cell lung cancer -1.393 7.5e-17
osteosarcoma -1.758 9.9e-03
psoriasis -1.600 4.3e-04
Rheumatoid arthritis -2.100 1.1e-02

 GWAS Trait (1)

Gene RIF (151)

AA Sequence

MLQACKMEGFPLVPPPSEDLVPYDTDLYQRQTHEYYPYLSSDGESHSDHYWDFHPHHVHSEFESFAENNF      1 - 70
TELQSVQPPQLQQLYRHMELEQMHVLDTPMVPPHPSLGHQVSYLPRMCLQYPSLSPAQPSSDEEEGERQS     71 - 140
PPLEVSDGEADGLEPGPGLLPGETGSKKKIRLYQFLLDLLRSGDMKDSIWWVDKDKGTFQFSSKHKEALA    141 - 210
HRWGIQKGNRKKMTYQKMARALRNYGKTGEVKKVKKKLTYQFSGEVLGRGGLAERRHPPH              211 - 270
//

Text Mined References (191)

PMID Year Title