Property Summary

NCBI Gene PubMed Count 599
PubMed Score 2121.26
PubTator Score 2165.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (28)

Disease log2 FC p
ependymoma 1.600 8.3e-03
esophageal adenocarcinoma 2.400 1.8e-02
psoriasis 1.600 4.3e-02
astrocytoma 1.100 1.9e-04
glioblastoma 3.200 2.2e-03
oligodendroglioma 1.300 3.6e-06
medulloblastoma, large-cell -2.700 2.1e-05
Duchenne muscular dystrophy 1.689 3.3e-05
autosomal dominant Emery-Dreifuss muscul... 1.288 2.9e-02
juvenile dermatomyositis 1.650 3.6e-09
adrenocortical carcinoma 2.721 8.6e-08
tuberculosis -1.200 3.3e-03
primary pancreatic ductal adenocarcinoma 4.630 7.6e-05
non-small cell lung cancer 2.647 1.6e-16
intraductal papillary-mucinous adenoma (... -1.800 4.9e-02
lung cancer 2.900 1.7e-04
pancreatic cancer 4.200 2.3e-04
breast carcinoma -1.300 1.9e-05
pediatric high grade glioma 1.600 2.1e-05
group 4 medulloblastoma -1.100 2.7e-02
primary Sjogren syndrome 1.500 1.5e-02
lung adenocarcinoma 2.443 1.1e-09
pterygium -1.400 1.4e-02
ulcerative colitis 2.000 1.7e-05
ovarian cancer 1.200 3.9e-02
pituitary cancer -1.900 1.1e-03
cystic fibrosis and chronic rhinosinusit... 1.486 3.6e-02
dermatomyositis 1.600 2.5e-02

Protein-protein Interaction (2)

Gene RIF (577)

PMID Text
27071409 Independent of obesity, high insulin levels but reduced levels of IGFBP-3 were associated with increased lung cancer risk in current smokers.
26975989 Study showed that IGFBP3 is dramatically induced in pancreatic tumors, and is abundantly produced in pancreatic cancer cells, causing muscle wasting through both impaired myogenesis via, at least, inhibition of IGF/PI3K/AKT signaling.
26902691 Metformin resulted in a significant reduction of IGF-1, IGF-1: IGFBP-3 molar ratio, insulin, FBG and HOMA-IR. On the other hand, metformin caused a significant increase of IGFBP-3.
26893016 Higher IGF-I levels among postmenopausal women and an elevated IGF-I:IGFBP-3 ratio among all women were associated with higher TDLU counts ; these associations were strongest among women with elevated mammographic density
26731648 Data indicate that IGF-binding protein 3 (IGFBP3) and F3 gene expression levels in formalin fixed paraffin embedded (FFPE) prostate cancer tissue would provide an improved survival prediction for prostate cancer patients.
26670461 Insulin-like growth factor binding protein-3 is a new predictor of radiosensitivity on esophageal squamous cell carcinoma
26637371 calcineurin in astrocytes was activated by Amyloid beta, leading to IGFBP-3 release.
26540630 Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells via integrin beta1 signaling.
26388613 Circulating levels of IGF-1, IGFBP-3 and their molar ratio were not associated with the risk of occurrence of colorectal adenoma
26378048 endogenous IGFBP-3 is a p53 target that plays a role in breast cancer cell responsiveness to DNA damaging therapy
26349977 polymorphism in IGFBP-3 rs2854744 A>C might be a potential predictor of esophageal squamous cell carcinoma risk and patient survival
26216267 Humanin Peptide Binds to Insulin-Like Growth Factor-Binding Protein 3 (IGFBP3) and Regulates Its Interaction with Importin-beta.
26121987 plasma level not associated with endometriosis risk
26074086 IGFBP-3 thus has the ability to influence many cell functions through its interactions with intranuclear pathways, but the importance of these interactions in vivo.
26069074 IGFBP-3 levels after ischemic stroke may independently predict functional outcome after one year.
26068014 Serum IGFBP3 was increased in hepatocellular carcinoma patients compared to patients with liver cirrhosis, but lower than in healthy controls.
26063735 Authors demonstrate that IGFBP3 is a direct TAp73alpha (the p73 isoform that contains the trans-activation domain) target gene and activates the expression of IGFBP3 in actively proliferating cells.
25987030 Loss of IGFBP3 expression is associated with Colorectal Cancer.
25966104 The current meta-analysis suggests that the IGFBP-3 C2133G polymorphism may confer susceptibility to colorectal cancer. [Meta-analysis]
25960224 The functional IGFBP3 A-202C polymorphism may influence the susceptibility and progression of breast cancer in the Chinese population.
25947142 Early development of Beta-cell autoimmunity is linked to circulating IGFBP3 levels.
25945837 Data indicate that IGF binding protein-3 (IGFBP-3) reduced transcription of a variety of integrins, especially integrin beta4.
25822686 Methylation of IGFBP-3 in colorectal cancer was identified to be significantly associated with risk of recurrence.
25742716 IGFBP-3 polymorphism is not a cause of delayed infancy-childhood transition in idiopathic short stature children.
25739014 The present study revealed the pleiotropic impact of the single clustered hepatic metastamiRs miR-96-5p and miR-182-5p on IGF-1R, and an inducing effect on IGF-II and IGFBP-3 in hepatocellular carcinoma.
25662950 These findings indicate that IGFBP-3 enhances etoposide-induced cell growth inhibition by blocking the NF-kappaB signaling pathway in gastric cancer cells.
25619494 Differences in IGF-axis protein expression and survival among multiethnic breast cancer patients
25556430 Expression of IGFBP3 in several HCC cell lines was lower than in normal cell lines. Overexpression of IGFBP3 induced apoptosis and reduced colony formation.
25553725 Report association of IGFBP-3 gene polymorphism rs11977526 with longevity in Chinese nonagenarians/centenarians.
25552351 -202 A/C IGFBP3 polymorphisms did not show any consistent association with clinical and laboratory features of acromegalic patients even after treatment.
25548030 Our results suggest that rs6214 on the IGF1 gene and rs2854744 near the IGFBP3 gene potentially play an important role with ASMI in Taiwanese older adults in a metropolitan area.
25525174 pioglitazone mediates regulation of IGFBP-3 via activation of PKA/DNA PK pathway in hyperglycemic retinal endothelial cells.
25482372 The unmethylated IGFBP-3 promoter is associated with resistance to radiotherapy in patients with non-small cell lung cancer.
25449421 the interaction between IGFBP-3 and PPARgamma is important for the growth-inhibitory effect of PPARgamma ligands in human breast cancer cells
25385818 The IGFBP3 polymorphism was associated with a higher baseline IGF1 in acromegaly.
25385317 The ratios of IGF-I/IGFBP-3 were increased in postmenopausal Taiwanese women with breast cancer, irrespective of their ages, ER and PR statuses, and HER2 expression.
25295265 no significant association was found between IGF-1 and IGFBP-3 levels and disease activity, systemic inflammation, metabolic syndrome features, or adipokines.
25285521 The combined influence of genetics and diet (daily intake of protein, fat and soy isoflavones) on IGF-1 and IGFBP-3 levels, were assessed.
25277046 The blood proteins IGF1, IGF2, IBP2, IBP3 and A2GL have been proposed as indirect biomarkers for detection of GH administration and as putative biomarkers for breast cancer diagnosis.
25179796 In women with normal somatotroph function, IGFBP3 levels do not change in the first trimester of pregnancy.
25127039 IGFBP3 hypermethylation may serve as an independent prognostic and predictive biomarker in stage II and III CRC patients.
25120154 This study provides initial evidence that protein normalized IGF-1 and IGFBP-3 and leptin levels increase in synovial fluid of women but not in men with OA versus those without OA.
25086184 IGFBP-3 inhibits TNF-alpha production and TNFR-2 signaling to protect against retinal endothelial cell apoptosis in diabetic retinopathy.
25081695 IGFBP-3 exhibits anti-apoptotic effects on paclitaxel-treated SGC-7901 cells via elevating Bcl-2 expression.
25059666 Data indicate insulin-like growth factor (IGF)-binding protein-3 (IGFBP3) as a miR-21 target gene in glioblastoma and suggest that the oncogenic miRNA miR-21 down-regulates the expression of IGFBP3, which acts as a tumor suppressor in human glioblastoma.
25028991 Results suggest that immediately postexercise testosterone and IGFPB-3 responses are significantly increased after endurance training followed by strength training but not after strength training followed by endurance training.
24953254 Here we review the literature on this paradoxical nature of IGFBP-3, its pro-apoptotic and growth-inhibitory actions versus its cytoprotective and growth-potentiating properties, and the implications of targeting IGFBP-3 for treatment of disease. [review]
24943688 Data indicate there was no significant difference in both serum insulin-like growth factor-1 (IGF-1) and insulin-like growth factor binding protein-3 (IGFBP-3) levels between breast cancer (BC) patients.
24942865 Akt3 is a negative regulator of IGFBP-3 protein.
24938707 IGFBP-3 SNP rs2270628 may contribute to the risk of ESCC in the Chinese Han population.
24928840 Genome-wide association and functional studies identify a role for IGFBP3 in hip osteoarthritis.
24926947 Our results suggest that in conditions in which IGF-I levels are low, such as young age and in short small for gestational age children, IGFBP-3 proteolytic activity is increased to ensure IGF-I bioavailability.
24915949 Low expression of IGF-1 and high expression of IGF-2 and IGFBP-3 in the placental tissue depending on preeclampsia severity were detected.
24905466 IGFBP-3 appears to exert a specific inhibitory effect on melanoma growth and dissemination
24878287 IGFBP-3 influences tumor cell proliferation, migration, and invasion and regulates STAT-1 expression in malignant glioma
24825082 Both serum IGF-1 and IGFBP-3 levels were significantly correlated with age, BMI, and serum c-peptide levels. serum IGFBP-3 levels showed significant correlation with HbA1c, total cholesterol, and LDL-cholesterol in the uncontrolled diabetic patients.
24811788 results support growth-promoting role of IGF system in placental/fetal development and suggest that IGF1R and IGFBP3 DNA methylation profiles are dysregulated in maternal impaired glucose tolerance, potentially affecting the fetal metabolic programming
24809065 An association was found between -202 A/C polymorphism of IGFBP3 gene with VO2max in men. An association was found between -202 A/C polymorphism of IGFBP3 gene with VO2max in men.
24785566 Data suggest development of islet autoimmunity and thus diabetes type 1 is subtly affected by early infant growth, however, IGFBP3 and IGF1/insulin-like growth factor I appear unlikely to be in causal pathway.
24587638 insulin, IGF-1 as well as IGF-1/IGFBP-3 ratio and the reduction of IGFBP-3 may be related to the initiation of colorectal cancer, but they are not related to the progression and outcome of the disease
24586243 Genetic polymorphisms in IGF-I and IGFBP-3 are associated with prostate cancer in the Chinese population.
24464126 this meta-analysis demonstrates that there is no association of IGFBP-3 gene rs2854744 and rs2854746 polymorphisms with CRC risk.
24457161 IGFBP-3 -202A>C polymorphism might contribute to prostate cancer susceptibility, especially in Asian men and hospital-based studies [meta-analysis]
24451943 results suggest that polymorphic variants of the IGF2 genes modulate gastric carcinogenesis. Moreover, when the IGF2 and IGFBP3 variants are evaluated together, a greater effect on GC risk is observed
24386080 HoxD10-targeted gene IGFBP3 has a role in suppressing gastric cancer cell invasion and favors the survival of gastric cancer patients.
24379526 In epiretinal membranes (ERMs), IGF1 and IGF1R mRNA levels were significantly higher in patients with diabetes compared to control subjects.
24368776 low blood IGFBP-3 is associated with atrial fibrillation in the elderly population and is an independent determinant of atrial fibrillation.
24351920 investigate the expression of IGF-1, IGFBP-3 and IGF-1R in STRO-1-positive dental pulp stem cells (DPSCs) and fully impacted wisdom teeth in relation to tooth development
24339922 IGFBP-3 may not play an important role in resistance to EGFR-TKIs
24337110 Data suggest that combined inhibition of epidermal growth factor receptor and sphingosine kinase-1 has potential as an anticancer therapy in triple-negative breast cancer in which insulin-like growth factor-binding protein-3 expression is high.
24310658 IGFBP-3-202A/C gene polymorphism did not seem to be associated with any of the cancer sites in the various genetic models and ethnicities. (Meta-analysis)
24175768 IGFBP-3 (rs3110697) was not associated with colorectal cancer risk in an Iranian cohort.
24094144 Data suggest that serum levels of free IGF1 (insulin-like growth factor-I) can be up-regulated by dietary factors (here, a 3-serving increase in milk consumption by postmenopausal women); total IGF1 and IGFBP3 levels in serum were unchanged.
24051179 insulin-like growth factors bound to IGFBP-3 remain in the circulation, whereas those bound to IGFBP-2 freely reach target tissues.
24022308 growth hormone receptor, insulin-like growth factor-1 receptor and insulin-like growth factors binding protein-3 have a role in the pathogenesis of non-melanoma skin cancers, especially squamous cell carcinoma.
23962053 IGF1R signaling might be associated with tumor aggressiveness, and IGFBP3 might show antiproliferative effects in pancreatic cancer.
23878061 downregulation of IGFBP3 expression is associated with hepatocellular carcinoma.
23864804 IGFBP-3 and TNF-alpha levels were not associated with insulin sensitivity in women with polycystic ovary syndrome.
23831640 These results suggest an important role for TGF-beta1 in osteosarcoma cell growth, with the induction of IGFBP-3 by TGF-beta1 serving in a negative-feedback loop to control cell growth by preventing activation of the IGF1R.
23792502 Low levels of IGF-I and IGFBP-3 observed in patients with advanced liver cirrhosis are corrected after liver transplantation. IGF-I and IGFBP-3 correlate negatively with MELD.
23789983 Studies indicate that modulation of IGF-I and IGFBP-3 concentrations by vitamin D may impact recombinant human (rh) GH dosing for the treatment of growth hormone deficiency (GHD).
23784592 High hepatic IGFBP-3 expression is associated with chronic hepatitis C.
23770368 studies provide evidence that overexpression of IGFBP-3 suppresses osteoblastic differentiation regulated by VDR in the presence of 1,25-(OH)2D3
23748063 Data indicate the effects of accelerated early infant growth on IGF-1/IGFBP-3 axis in small for gestational age (SGA) infants.
23720424 Data indicate that IGFBP3 is abundantly secreted during prostatic stromal differentiation.
23619263 In cirrhotic patients admitted to hospital due to complications of the disease, IGF-I and IGFBP-3 serum levels were associated with variables related to liver dysfunction and to more advanced liver disease.
23611528 Decreased IGFBP3 serum levels are associated with sepsis.
23592916 This is the first demonstration of the role of IGFBP-3 in inhibiting monocyte-endothelial cell adhesion.
23527725 The change of ADAM28 and IGFBP-3 gene expression is present in the normal tissue in overweight/obese patients with colorectal cancer only, and the observed variability of ADAM28 and IGFBP-3 expression may be an initial process of cancer proliferation
23527244 IGFBP3 A-202C and Gly32Ala polymorphisms are not associated with colorectal cancer susceptibility.
23498137 These results suggest that NNK inhibits IGFBP-3 expression to abrogate anti-tumor actions of the IGFBP-3/IGFBP-3R system in smoking-induced lung cancer.
23473966 The IGF-I system is of significance in human Alzheimer disease. Serum but not CSF levels of IGFBP3 were higher in AD patients compared to controls.
23464449 That IGFBP3 A-202C was a marginal risk factor of prostate cancer.
23383064 reduced levels of IGFBP-3 in circulation and reduced expression of IGFBP-3 in macrophages in obesity may result in suppression of its anti-inflammatory functions
23348700 Deguelin suppresses the growth of breast cancer cells via its impact on the expression of IGFBP3.
23341348 analysis of 16 IGF pathway SNPs, including IGF-1 and IGFBP-3, reveals that prostate cancer risk varies by intakes of dietary protein
23185474 inverse association was shown between IGFBP-3 and lung cancer in case-control studies; circulating level of IGFBP-3 underwent a decline during tumorogenesis and development of lung cancer, suggesting IGFBP-3 a promising candidate for the biomarker of lung cancer[meta-analysis]
23178489 IGFBP-3 co-translocation to the nucleus of breast cancer cells and its formation of a complex with DNA-PKcs and EGFR in response to DNA damage shows its potential involvement in the regulation of DNA repair.
23174226 The IGFBP-3 gene A-202C polymorphism does not modulate the risk of erectile dysfunction
23158139 Results suggested that interaction of SREBP-2 gene polymorphisms and the relationship between the polymorphisms and clinical phenotype of IGFBP-3 were closely related to increased ANFH risk in the Chinese population.
23041555 Insulin-like factor binding protein-3 promotes the G1 cell cycle arrest in several cancer cell lines
23036517 Increased HMGA1 expression in human chondrocytes is associated with increased expression of IGFBP-3.
23011725 Tumor had higher IGFBP-3 cytoplasmic and nuclear staining than benign histologies.
22951368 The IGF-I along with the IGFBP-3 levels explained almost one third of the variation of triglycerides.
22936258 Ghrelin secretion is elevated in children with lower IGF-I/IGFBP-3 ratio. It seems that lower bioactivity of IGF-I is stimulating factor for ghrelin synthesis.
22894543 Common IGF-1 and IGFBP-1/IGFBP-3 SNPs are not associated with body size in early life.
22892437 Data suggest that serum IGF1 (insulin-like growth factor 1) but not serum IGFBP3 is under control of glycemic index of diet; low glycemic load diet resulted in modest lowering of fasting serum IGF1 but had no effect on serum IGFBP3.
22884472 Structural and ligand-binding properties of the insulin-like growth factor-binding protein (IGFBP)-3 in patients with poorly controlled diabetes mellitus type 2 were investigated using boronic acid- and lectin-affinity chromatography.
22882716 Low serum IGFBP-3 levels might be associated with higher levels of periodontal disease. Neither serum IGF-I nor IGF-I/IGFBP-3 ratios were associated with periodontitis.
22879989 These findings provide direct physiological and molecular evidence for a role of FOXA1 in controlling cell proliferation through the regulation of IGFBP-3 expression in prostrate cancer.
22847383 The IGF-1/IGFBP-3 ratio, an indicator of free IGF-I levels, was significantly associated with increasing risk of all-cause mortality.
22801219 In antiestrogen-resistance breast cancer cells, IGFBP-3 interacted with GRP78, resulting in disruption of the GRP78-caspase-7 complex, activating caspase-7, inducing apoptosis.
22778398 IGFBP3 is a mediator of doxorubicin-induced senescence of MCF-7 tumor cells.
22751133 Results show that IGFBP-3 stimulates autophagy and thereby promotes the survival of breast cancer cells exposed to conditions that represent the adverse microenvironments encountered by solid tumor cells in vivo.
22745191 Data show that HMGA1 is required for gene activation of the IGF-binding proteins 1 (IGFBP1) and 3 (IGFBP30).
22739332 Associations of cord plasma IGFBP-3 levels and the IGFBP3 gene variants but not of IGF1 promoter and INS VNTR polymorphisms with IGF-I, IGF-II, or IGFBP-3 levels in utero.
22643116 Insulin-like growth factor II mRNA-binding protein 3 (IMP3) expression might be used as an independent prognostic factor in the subgroup of OSCC.
22565227 Data show that the IGFBP-3 variant alleles was associated with lower IGFBP-3 protein levels, a difference most pronounced in Whites.
22554827 IGFBP-3 is associated with increased risk of type 2 diabetes in women
22543588 Results suggest that loss of IGFBP-3 expression by promoter methylation in tumor cells treated with CDDP may activate the PI3K/AKT pathway through the specific derepression of IGFIR signaling, inducing resistance to CDDP.
22527168 There was no evidence of any dietary associations with IGFBP-3 or IGF-II.
22500655 high expression in high-grade bladder carcinoma cells makes IMP3 for an attractive target for therapy. The tumour promoting effect of IMP3 is independent from its regulatory action on IGF2 and CD44 expression
22494072 Data indicate that IGFBP-3 suppresses VEGF expression in vascular endothelial and head and neck squamous cell carcinoma (HNSCC) cells.
22475139 The expression of IGF-1 and IGFBP-3 decreased in nonalcoholic fatty steatosis hepatocyte models.
22442270 Changes in IGFBP-3 levels were not significantly associated with mortality for cardiovascular diseases.
22441125 Studies demonstrate that IGFBP-3 and GalNAc-T14 are colocalized in MCF-7 cells, and confirmed the interaction between IGFBP-3 and GalNAc-T14; these results reveal a minimal region of GalNAc-T14 that was sufficiently bound to the full-length IGFBP-3.
22415807 A four single nucleotide polymorphism haplotype of IGFBP-3 was associated with a decreased risk of differentiated thyroid carcinoma in Caucasian Americans.
22415309 our study establishes IGFBP3 as a direct HIF-1alpha target gene and that polysome enrichment of IGFBP3 mRNA may permit continuous translation under hypoxic conditions
22389159 Data show that after insulin-like growth factor binding protein-3 (IGFBP-3) was silenced by small interfering RNA, the potential of nimotuzumab to enhance cisplatin (DDP)-mediated cytotoxicity was inhibited in KYSE30 cells.
22381038 The AAG haplotype allele of the -672A>G, -202A>C and c.95C>G polymorphisms in the IGFBP3 gene may be associated with advanced endometriosis in Korean women.
22363400 These results suggest that the normal PGH-IGF-I-IGFBP3 axis in pregnancy is abnormal in Type 1 Diabetic pregnancies.
22347413 Heavy smokers carrying susceptible IGF1, IGF2, and IGFBP3 polymorphisms have a higher risk of lung cancer.
22332214 IGF1 haplotypes are associated with genetic susceptibility to high myopia in Chinese adults, whereas IGFBP3 and IGFBP4 are unlikely to be important in the genetic predisposition to high myopia.
22328165 There is a positive associations between serum IGF-I or the IGF-I/IGFBP-3 ratio with plasma aldosterone in women but not in men.
22318747 Pediatric chronic kidney disease patients display elevated serum concentrations of total IGFBP3.
22278433 Homozygosity for the GHR-exon3 full-length allele and/or the -202C-IGFBP3 allele are associated with less favorable short- and long-term growth outcomes after rhGH treatment in patients with Turner syndrome.
22253890 Prospective associations of insulin, IGF-I, IGF-II and IGFBP-3 with physical performance in Caerphilly Prospective Study and cross-sectional insulin, IGF-I, IGF-II, IGFBP-2 and IGFBP-3 in the Boyd Orr cohort, were examined.
22246875 This study demonistrated that IGFBP3 was significantly decreased in skeletal muscel in patient with amyotrophic lateral sclerosis.
22167391 In patients with esophageal squamous cell carcinoma, reduced IGFBP-3 expression may be a risk factor for advanced clinicopathological classification and poor patient survival.
22128038 The expression of IMP3 was significantly associated with the risk of death in oral squamous cell carcinoma.
22113073 In older men, higher IGF1 and an increased ratio of IGF1/IGFBP3 are associated with abdominal aortic aneurysm, while IGFBP1 is independently associated with increased aortic diameter.
22085490 Endogenous IGFBP-3 modulates adhesion-migration dynamics in endometrial cancer cells, implying that it may be important in regulating metastasis in this disease.
22032863 a reference value model based on age, sex, and pubertal stage can improve the diagnostic utility of IGF-1 and IGFBP-3 levels in the evaluation and management of Korean children and adolescents with growth disorders
22026507 Results indicate that in patients with severe growth hormone deficiency (IGHD), although the various IGF-I and IGFBP-3 genotypes may play a role in recombinant human growth hormone (rhGH) responsiveness, there was no effect on final height.
22004906 Lower circulating levels of IGF1 and IGFBP3 were independently associated with ARDS case status.
22001433 -396 C/T polymorphism in the promoter of IGFBP3 gene correlates with lower birth length.
21944866 Polymorphic variation in the IGFBP3 gene is associated with extremely tall stature.
21930730 High IGFBP-3 levels were inversely associated with a risk of Barrett's oesophagus.
21898383 study found a positive association between "ever increase" in IGF-1 or IGF-1/IGFBP-3 and the presence of colorectal adenoma
21892705 Results could not confirm the recently published hypothesis that rs2854744 in the IGFBP3 gene is associated with UBC risk.
21852217 We genotyped single-nucleotide polymorphisms of IGF1, IGF2, IGF1R, IGF2R, IGFBP1, IGFBP3, IGFBP5, IRS1, IRS2, and IRS in pancreatic cancer patients
21823995 In placentas from pregnancies with IUGR an overexpression of the IGF-2 and the insulin-like growth factor binding protein (IGFBP)-3 genes was found.
21788435 High IGFBP-3 is associated with acoustic neuromas.
21761353 IGF-I and the IGF-I/IGFBP-3 molar ratio were positively, although not statistically significantly, associated with postmenopausal breast cancer risk
21737444 The enhanced cell motility that accompanies reactivation of IGFBP-3 expression in liver cancer by HDAC inhibition suggests the possibility of increased metastatic spread despite inhibited cell proliferation.
21701930 Global comparison of gene expression profiles identified 2 striking differences in treated tumors relative to untreated tumors: a marked increase in IGBFP3 and concomitant decrease in TGFb-R2 gene and protein expression.
21698457 An inverse relationship was found between IGF-I concentration and melanoma, but clear associations were not observed between malignant melanoma and upper tertiles of IGFBP-3.
21697095 Bone morphogenetic protein-1 processes insulin-like growth factor-binding protein 3.
21648284 The significant increase in IGFBP-3 measured by RIA, but not ICMA, provides evidence of IGFBP-3 proteolysis during acute GH stimulation.
21636299 High IGFBP-3 is associated with congenital adrenal hyperplasia due to 21-hydroxylase deficiency.
21585623 Higher levels were associated with a higher Expanded Disability Status Scale score but not with the Multiple Sclerosis Severity Scale. IGFBP-3 might not have the suggested pathogenetic role in secondary progressive MS.
21562710 The selected IGF-I and IGFBP-3 SNPs did not show any strong evidence for being associated with breast cancer risk.
21551235 In cancer cells, IGFBP-3 directly interacted with Erk1/2, inactivating Erk1/2 & Elk-1, & suppressing transcription of early growth response protein 1 & its target genes, basic fibroblast growth factor & platelet-derived growth factor.
21536469 The AA genotype at IGFBP-3 gene polymorphism is associated with reduced risks of Prostrate cancer and benign prostatic hyperplasia
21536375 findings indicate that IGFBP-3 exerts antitumor effects via IGF-independent mechanisms which involve activation of caspase-dependent apoptosis and cross-talk with NF-kappaB signaling
21529443 IGFBP-3 interacts with TRalpha1 and inhibits triiodothyronine responsive gene transcription.
21525788 IGFBP3 is involved in early metastatic dissemination in colorectal cancer
21521316 Data show that leptin is better than any other biological parameter for monitoring the efficacy of renutrition, including albumin, transthyretin, leptin, IGFBP-1, IGFBP-3 and IGF-1.
21520165 The results suggest that preoperative IGFBP-3 circulating levels determination may be useful to predict Gleason score upgrading alone and/or in combination with biopsy T-stage and biopsy Gleason score.
21520041 The extracellular addition of IGFBP-3 to living cells results in rapid uptake and nuclear delivery of IGFBP-3.
21478207 the associations between serum concentrations of IGF-I and IGF binding protein-3 (IGFBP-3) and cardiovascular risk factors
21474793 serum changes of three glycoproteins, galectin-3 binding protein, insulin-like growth factor binding protein 3, and thrombospondin 1, was associated with the development of hepatocellular carcinoma
21471542 Data show that IGFBP-3 levels were lower with low levels of physical activity and lower WHR.
21455575 up-regulation of IGFBP3 induced by 5-FU plays an important role in the potent anti-tumor effect of 5-FU combined with anti-androgens on CRPC.
21447640 Human IGFBP-3 overexpression impairs glucose regulation in mice via an inhibition of insulin secretion.
21447628 IGFBP-3 positively and negatively impacts on IGF1-induced lung cancer development.
21435441 IGFBP-3 has a role in enhanced pericyte ensheathment, reduced microglial activation, increased microglial apoptosis, and neuronal protection after ischemic retinal injury
21392749 Serum concentrations of insulin-like growth factor I and insulin-like growth factor binding protein 3 do not correlate with breast cancer development.
21388950 Binding between insulin-like growth factor 1 and insulin-like growth factor-binding protein 3 is not influenced by glucose or 2-deoxy-D-glucose
21383009 The IGFBP-3/IGFBP-3R system therefore plays a pivotal role in the pathogenesis of asthma and can serve as a newly identified potential therapeutic target for this debilitating disease.
21378090 Decreased levels of circulating IGFBP3 predict increased all-cause mortality in Australian men.
21347663 Genetic polymorphism of the IGFBP-3 gene may be involved in the etiology of bladder transitional cell carcinoma
21254935 The A/A genotype and A allele of the IGFBP-3 promoter -1590 site may represent a genetic risk factor for nonsmall cell lung cancer in a Chinese Han population.
21216879 Polymorphisms in the IGFBP3 gene on chromosome 7p12.3 are associated with circulating IGF-I and IGFBP-3.
21195059 These data suggest that IGFBP3 and BAG1 may be key markers of radiosensitivity that enhance the susceptibility of squamous cell esophageal cancer to radiotherapy
21140206 independent effects from IGFBP1, IGFBP3 diplotypes, and BRCA family status on IGFBP-3 levels were observed
21078522 Genetic variation with IGFII and IGFBP-3 may influence endometrial cancer risk in Caucasians.
21078522 Observational study of gene-disease association. (HuGE Navigator)
21068693 rhIGFBP-3 treatment reduces intestinal cell proliferation, resulting in decreases in crypt depth and muscularis externa thickness in cystic fibrosis transmembrane conductance regulator deficient mice.
20945273 The aim of this study was to evaluate the relationship between levels of IGF-II or IGFBP-3 in cervical scrapes with cervical cancer and precancerous lesions.
20921904 Ghrelin and IGFBP-3 may play a role in the bone metabolism in the inflammatory bowel disease.
20920870 Clinical characteristics among the three IGFBP3-202 A/C genotype, AA, AC and CC, did not display any significant difference.
20920870 Observational study of gene-disease association. (HuGE Navigator)
20889360 At peak exercise performance, in women IGF-I showed significant associations to peakVO and maximum power output, IGF-I/IGFBP-3 ratio was associated with maximum power output.
20884247 Data indicate after 3 cycles of treatment IGF-1 significantly declined, IGFBP-1 significantly increased, and IGF-2 and IGFBP-3 were not significantly changed.
20860465 Host genetic variants in IGBFP3 impact on survival of patients with advanced gastric cancer treated with palliative chemotherapy.
20860465 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20851879 IGFBP-3 can either inhibit or enhance EGF-mediated growth of breast epithelial cells dependent upon the presence of fibronectin
20848532 Upregulated endogenous IGFBP-3 and TGF-beta1 expression regulates excess collagen IalphaI production and contributes to fibrosis and stricture formation in Crohn's disease.
20810604 variation in the IGFBP3 and IGFALS genes seems to influence circulating IGFBP-3.
20810604 Observational study of gene-disease association. (HuGE Navigator)
20801067 High-intenstiy training/acidosis is a stimulus for exercise-induced cortisol/hGH secretion, but not for IGF-1 and IGFBP-3 secretion.
20734064 Observational study of gene-disease association. (HuGE Navigator)
20731527 height and BMI are associated with IGF-I and its binding proteins, which may be mechanisms through which body size contributes to increased risk of several cancers
20677014 Observational study of gene-disease association. (HuGE Navigator)
20634197 Meta-analysis of gene-disease association. (HuGE Navigator)
20628624 Meta-analysis of gene-disease association. (HuGE Navigator)
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20613589 Microarray analysis showed IGFBP3 was highly expressed in early osteogenesis when comparing levels at day 1 with those at day 3.
20599318 Study observed significant down-regulation of IGFBP-3 expression in primary human hepatocellular carcinoma (HCC) tissues when compared to adjacent histologically normal tissues. In this study, we functionally mapped the entire 3'-UTR of the IGFBP-3 mRNA.
20587610 Observational study of gene-disease association. (HuGE Navigator)
20580999 Observational study of gene-disease association. (HuGE Navigator)
20540360 Observational study of gene-disease association. (HuGE Navigator)
20513670 IGFBP3 plays a critical role in esophageal tumor progression by facilitating epithelial-to-mesenchymal transition and invasive growth of transformed human esophageal cells.
20501753 Study shows the associations of IGFBP-2, -3, and -5 expression with increasing grades of malignancy in astrocytomas. IGFBP-3 is identified as a novel prognostic glioblastoma biomarker.
20484221 A comprehensive analysis, between common genetic variation in the IGF1, IGF binding protein (BP) 1, and IGFBP3 genes with IGF-I and IGFBP-3 blood levels, and prostate cancer (PCa) risk, among Caucasians, was conducted.
20484221 Observational study of gene-disease association. (HuGE Navigator)
20468064 Observational study of gene-disease association. (HuGE Navigator)
20453000 Observational study of gene-disease association. (HuGE Navigator)
20427254 adjusting for IGF-II, the inverse association of IGFBP-3 with cancer mortality shifted from significance into non-significance when adjusting for IGF-II levels.
20423985 The plasma IGF1/IGFBP3 ratio was associated with bone mass acquisition in this period, and it may thus serve as a surrogate marker of bone mass gain in this population.
20416304 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20403354 Observational study of gene-disease association. (HuGE Navigator)
20378848 Link lower concentrations of circulating IGF-1 or its unbound fraction (IGF-1:IGFBP-3 ratio) to greater metabolic risk burden for cardiovascular disease and demonstrate substantial heritability for serum IGF-1 concentrations.
20357812 silencing of IGFBP3 in melanoma is due to the methylation of its promoter, and that overexpression of IGFBP3 induces apoptosis and suppresses cell survival and growth
20350746 The results supported the protective role of -202 A/C SNP of the IGFBP3 gene against Prostate Cancer in Korean men.
20350746 Observational study of gene-disease association. (HuGE Navigator)
20307522 breast cancer progression causes alterations of IGFBP-3 glycosylation. The extent of changes increases with breast cancer severity.
20302654 Observational study of gene-disease association. (HuGE Navigator)
20228135 A putative nuclear export sequence (NES) was identified in IGFBP3 between amino acids 217 and 228. Mutation of the sequence prevented nucleocytoplasmic shuttling of IGFBP3 and blocked its ability to induce apoptosis.
20219400 IGFBP3 promoter methylation did not influence protein expression in gastric adenocarcinoma.
20215856 SNP (rs2453839) in the IGFBP3 gene was significantly associated with a higher risk of osteonecrosis of the femoral head (P=0.0061, OR 7.74)
20215856 Observational study of gene-disease association. (HuGE Navigator)
20204283 IGFBP-3 expression in breast cancer is associated with poor outcome.
20155489 Findings suggest that common genetic variation in the IGFBP3 gene is not related to IGF-I levels and mammographic density.
20155489 Observational study of gene-disease association. (HuGE Navigator)
20145156 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20144192 Observational study of gene-disease association. (HuGE Navigator)
20121533 maternal mean insulin-like growth factor binding protein 3 (IGFBP-3) levels are significantly reduced in cases complicated by delivery <32 completed weeks
20119675 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
20102313 local expression of IGFBPs in podocytes and endothelial cells might contribute to the pathogenesis of glomerular disease and IGFBP-1 and -3 are potential non-invasive markers of focal segmental glomerulosclerosis.
20099974 High serum IGFBP3 levels are associated with prostate cancer.
20084546 Polymorphisms in IGFBP3 gene is associated with breast cancer.
20084546 Meta-analysis of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20051649 IGFBP-3 peaked at 14 yr in boys, and 11 yr in girls. Girls had higher IGFBP-3 levels than boys.
20039319 Observational study of gene-disease association. (HuGE Navigator)
20023704 Data show that basal methylation status of IGFBP-3 before treatment may be a clinical biomarker and a predictor of the chemotherapy outcome.
20003326 data suggests that IGFBP-3 silencing through IGFBP-3 promoter methylation in the absence of p53 overexpression is associated with cancer progression
19960406 Cellular production of IGFBP-3 leads to G1 cell cycle arrest with inhibition of CDK2 and CDK4.
19948975 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and genetic testing. (HuGE Navigator)
19944347 BMI, waist to hip ratio and waist circumference were positively associated with IGFBP-3 (IGF-binding protein 3) levels in non-Hispanic black men and non-Hispanic white women
19941883 Results suggest a model in which IGFBP3, leptin and T3 act as non-immune factors to maintain a larger pool of naive CD8 T cells in healthy nonagenarians.
19938081 Gene-gene interactions were identified between variants in HOXA, HOXD, and IGFBP3 and with previously associated single nucleotide polymorphisms in mitochondrial-mediated apoptotic genes.
19938081 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19919528 These results indicate that endogenous IGFBP-3 is anti-proliferative and pro-migratory in Hs578T cells and that these effects are IGF-independent.
19917654 In older men, both lower and higher IGF1 and IGFBP3 levels may be metabolically unfavourable risk factors
19913121 Observational study of gene-disease association. (HuGE Navigator)
19863750 IGFBP-3 and IGF-1 decreased significantly following regular physical activity in children and adolescents with type 1 diabetes.
19858071 IGF1, IGFBP1 and IGFBP3 genetic variants may have roles in ovarian cancer risk
19858071 Observational study of gene-disease association. (HuGE Navigator)
19846909 Findings suggest that IGFBP-3 may play a role in tumorigenesis, and that IGFBP-3 levels could be used in the future in cancer risk assessment/prevention or as markers of response to cancer treatments.
19845745 The current analysis of the IGF-1 system showed no significant differences in serum concentrations of total and free IGF-1, IGFBP-2 and IGFBP-3 between sporadic ALS and control groups.
19833751 These data show that CWP was not associated with perturbations in IGF-1 and IGFBP-3 concentrations, and suggest that IGF-1 is unlikely to be etiologically important in relation to CWP.
19800385 glycosylation pattern of IGFBP-3
19789190 Observational study of gene-disease association, gene-gene interaction, and gene-environment interaction. (HuGE Navigator)
19786971 results support the function of IGFBP3 gene polymorphisms in modulating IGF-I activity and lipid levels in adolescents.
19786462 Body mass index contributes to racial differences in IGFBP3
19784788 Association of IGFBP3 polymorphisms with colorectal polyps and colorectal cancer risk
19784788 Observational study of gene-disease association. (HuGE Navigator)
19764562 The expression of IGFBP-3 decreased significantly in lower differentiated ovarian cancer tissues compared with that in high and moderate differentiated ovarian cancer tissues.
19734278 Proteolysis of IGFBP-3 into two discrete fragments does not significantly increase IGF bioavailability.
19692168 Observational study of gene-disease association. (HuGE Navigator)
19672706 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
19634593 Genetic and lifestyle chronic disease risk factors influence IGF1 and IGFBP3 circulating levels differently in African Americans and whites.
19634593 Observational study of gene-disease association. (HuGE Navigator)
19633297 IGFBP-3 in MCF-10A cells requires SphK1 activity and S1P1/S1P3, suggesting that S1P, the product of SphK activity and ligand for S1P1 and S1P3
19625176 Observational study of gene-disease association. (HuGE Navigator)
19596932 results suggest that the levels and subcellular localization of local IGFBP-3 play a role in osteosarcoma development
19591553 On the first day of life, mean serum IGFBP-3 levels were significantly lower in SGA babies and correlated with weight, length, head circumference, and ponderal index.
19588500 Data show that IGFBP-3 is regulated by the PI3-kinase/AKT and MAPK/ERK1/2 pathways.
19568604 Menopause causes reduction of IGF-I/IGFBP-3 molar ratio. Women have the trend of progressive hypoactivity of GH to stimulate IGF-I and IGFBP-3 secretions with age.
19556345 These studies reveal multisite phosphorylation of IGFBP-3 that both positively and negatively regulate its apoptotic potential.
19551864 Observational study of gene-disease association. (HuGE Navigator)
19551141 MMP1 and MMP3, but not CDH1, IGFBP3, STK15 or VEGF, appear to play roles in familial and sporadic renal cell carcinoma
19551141 Observational study of gene-disease association. (HuGE Navigator)
19540231 Demonstrate substrate bound IGFBP3-mediates endocytosis in the human retinal pigment epithelial cell line.
19527514 Observational study of gene-disease association. (HuGE Navigator)
19509068 IGFBP-3 inhibits proliferation, adhesion, migration, and invasion processes of prostate tumor cells.
19492232 carrying the IGFBP3(insulin-like growth factor binding protein 3) G2133C GC heterozygote or CC homozygote had a significant 1.55-fold increased risk of colorectal cancer (CRC) in an allele dose-responsive manner
19492232 Observational study of gene-disease association. (HuGE Navigator)
19491931 Circulating levels of IGF1, IGFBP3 and IGFBP3 A-202C play a crucial role in carcinogenesis and could serve as susceptibility biomarkers for cancer development.
19491931 Meta-analysis of gene-disease association. (HuGE Navigator)
19477944 IGF/IGF-IR axis-independent actions of IGFBP-3; potential underlying mechanisms involved & subsequent biological significance, focusing on functional binding partners & clinical significance of IGFBP-3 in assessment of cancer risk [review]
19455605 Circulating levels of intact IGFBP3 measured after diagnosis is associated with increased risk of prostate cancer-specific death.
19453261 Observational study of gene-disease association. (HuGE Navigator)
19449212 These results indicated that polymorphisms of IGFBP3 might have different effect in different types of cancer and different population.
19414355 High IGFBP-3 is associated with breast cancer.
19332270 Increased myocardial IGFBP-3 expression in 23 failing hearts from patients undergoing cardiac transplantation for end-stage dilated or ischemic cardiomyopathy.
19258508 There is a close relationship in vitro and in vivo between NKX3.1 and IGFBP-3. The growth-suppressive effects of NKX3.1 in prostate cells are mediated, in part, by activation of IGFBP-3 expression.
19257984 Data show that the expression of IGFBP-3 gene in the senescent 2BS cells was enhanced.
19240240 Common IGFBP-3 SNPs, especially rs2854746, influence plasma IGFBP-3 levels among African Americans and Caucasians.
19240240 Observational study of gene-disease association. (HuGE Navigator)
19223521 The present study found inverse associations between insulin-like growth factor 1 or IGF binding protein 3 levels and mortality from all causes
19217707 High IGFBP3 concentrations in amniotic fluid at the beginning of the second trimester are associated with increased risks of small for gestational age (SGA) while 19CA/20CA genotype at IGF-I VNTR polymorphism is associated with reduced risks of SGA.
19217707 Observational study of gene-disease association. (HuGE Navigator)
19207313 Serum levels of IGF-1, IGF-2, ALS, and IGFBP-3 were reduced in children with congenital disorders of glycosylation.
19194113 For IGF-1, IGFBP-3 and SHBG, no differences were found between surgically and naturally postmenopausal women
19190540 A pharmacokinetic and dosing study of intravenous insulin-like growth factor-I and IGF-binding protein-3 complex to preterm infants.
19170196 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
19158946 IGFBP3 is a new regulator of hypocretin cell physiology that may be involved not only in the pathophysiology of narcolepsy, but also in the regulation of sleep in normal individuals, most notably during adolescence
19138871 There were no associations for IGFBP-3 and CRP serum levels
19129715 Three novel IGFALS gene mutations resulting in total ALS and severe circulating IGF-I/IGFBP-3 deficiency in children of different ethnic origins.
19127217 Effects of different CMV-heat-inactivation-methods on IGFBP3 in human breast milk.
19124510 Observational study of gene-disease association. (HuGE Navigator)
19124506 Observational study of gene-disease association. (HuGE Navigator)
19121847 Insulin-like growth factor-II and insulin-like growth factor binding protein-3 may be novel prognostic markers in metastatic ovarian carcinoma.
19077426 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
19064572 Observational study and meta-analysis of gene-disease association. (HuGE Navigator)
19064126 Observational study of gene-disease association. (HuGE Navigator)
19036873 hypoxic pulmonary artery smooth muscle cells produce TGF-beta1 that acts in an autocrine fashion to induce IGFBP-3 through PI3K/Akt
19020726 insulin-like growth factor binding protein 3 has a role in progression of oral squamous cell carcinoma
19019335 Observational study of gene-disease association. (HuGE Navigator)
19004037 IGFBP-3(insulin-like growth factor binding protein 3)levels were significantly elevated in patients with Systemic Scleroderma compared with systemic lupus erythematosus or controls.
18992263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18992148 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18984657 The -202 A allele of IGFBP3 promoter region is associated with increased IGFBP-3 levels and growth velocity during rhGH treatment in prepubertal GHD children.
18984657 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18929499 Genetic and epigenetic variability in the gene for IGFBP-3 is associated with increased serum IGFBP-3 levels and retarded growth in short children born small for gestational age
18929499 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18818748 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
18812263 Non-hispanic blacks have the highest molar ratio of IGF-I:IGFBP-3 at all ages
18676680 Observational study of gene-disease association. (HuGE Navigator)
18636124 Observational study of gene-disease association. (HuGE Navigator)
18624627 results did not support a relationship between GH T1663A and IGFBP3-202A/C with ischemic stroke in Chinese
18618736 A high IGFI:IGFBP3 ratio was associated with increased benign prostate hyperplasia risk, and high serum IGFBP3 was associated with decreased BPH risk among men with severe symptoms.
18615538 None of the components in the IGF-1 pathway including IGFBP3, PI3k, and PTEN influence the relation between IRS-1 genotype and prostate cancer risk. Ther is no association between carriage of the variant IRS-1 gene and prostate cancer risk.
18602100 A new approach for designing protein delivery systems using IGFBP-3/5 derived peptides based on the molecular mechanisms of IGF-independent activities of IGFBPs.
18596909 the association between common genetic variation in the IGFBP3 genes in relation to circulating IGFBP3 levels and breast cancer risk
18596909 Observational study of gene-disease association. (HuGE Navigator)
18562769 Observational study of gene-disease association. (HuGE Navigator)
18534134 This study suggests that there is an interaction between leptin, IGF-1, IGFBP-3 and insulin resistance in patients with chronic kidney disease.
18498652 Low expression of IGFBP-3 mRNA in normal colonic mucosa predicts increased risk of adenomas
18481170 IGF-I, IGF-II and IGFBP-3 mRNA expression and tissue levels of IGF peptides are regulated by different mechanisms
18471292 associations of some breast cancer risk factors with intact levels of IGFBP-3 are different from those with total (intact and fragmented) IGFBP-3 levels
18459102 The stroma--particularly reactivated stroma--is the main source of IGFBP-3 in the prostate, suggesting that this peptide acts as a mediator of stromal-epithelial interactions
18450319 IGFBP-3 promoter polymorphisms of -1590 C>A and -202 A>C might be a genetic risk factor for lung cancer
18450319 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
18410545 This study is the first to demonstrate that the systemic levels of IGF axis components are associated with the presence & severity of PAD, and that the inflammatory status of the ischaemic limb affects the transfemoral concentrations of IGF-1 & IGFBP-3.
18398029 Observational study of gene-disease association. (HuGE Navigator)
18375957 Levels of circulating insulin growth factor I (IGF-I) and insulin-like growth factor-binding protein 3 and breast cancer risk were investigated.
18335323 data suggest that low concentrations of insulin-like growth factor-I (IGF-I) and insulin-like growth factor binding protein-3 (IGFBP-3) could be a reliable marker to differentiate benign from malignant ovarian tumors
18329388 IGFBP-3 regulates the appearance of several biomarkers of senescence after repeated exposures of WI-38 fibroblasts to tert-butylhydroperoxide and ethanol.
18287864 functional variants of insulin-like growth factor-binding protein-3 might be important markers for gastric cancer susceptibility
18287864 Observational study of gene-disease association. (HuGE Navigator)
18259111 Higher early levels of the human milk IGF system might contribute to maturation of the infant gut.
18178497 A concurrence of elevated GH levels and decreased IGF-I, IGFBP-3, and total ghrelin levels during the early burn injury period.
18177247 These findings suggest that serum levels of IGFBP-3 (and possibly IGF-I) are associated with the rate of HIV disease progression in women.
18171112 The role of IGFBP-3 on senescence depends on the genetic background of the donor, and additional factors might be important to maintain the senescent phenotype.
18163429 Observational study of gene-disease association. (HuGE Navigator)
18162523 in PC-3 cells, RXR-alpha is not required for the nuclear translocation of IGFBP-3 and that IGFBP-3 can induce apoptosis in human prostate cancer cells without binding RXR-alpha.
18084616 microsatellite instability in CPG-island-metahylator-high colorectal cancers, & this relationship is limited to p53-negative tumors.
18059035 Observational study of gene-disease association, gene-gene interaction, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18031946 Observational study of gene-disease association. (HuGE Navigator)
18031946 no major role of the assessed genetic variation within the IGF1 and the IGFBP3 genes in CRC risk.
18006928 Observational study of gene-disease association. (HuGE Navigator)
17997337 study established age- and sex-specific reference ranges for serum IGF-1 and IGFBP-3 levels
17972510 This study supports the role of IGFBP-1, -3 and -7 as potential tumour suppressor genes in human breast cancer.
17959403 The N-terminal IGF-binding protein-3 fragment induces apoptosis in human prostate cancer cells in an IGF-independent manner
17957164 Serum IGFBP-3 was not altered in neonates with intrauterine growth retardation.
17952116 IGFBP-3 plays an important role as an invasion-metastasis suppressor in ovarian endometrioid carcinoma.
17912004 Osteopenia is common in children with cerebral palsy and may be associated with lower IGF-1 and IGFBP-3 levels
17879951 In a group of older US men, a strong inverse association between IGFBP-3 and lower urinary tract symptoms was observed.
17827406 E7-mediated destruction of nuclear IGFBP-3 correlates with the inhibition of IGFBP-3-induced apoptotic cell death.
17823260 study reports a methylation-dependent upstream stimulatory factor (USF) binding site influencing the basal and insulin-stimulated transcriptional activity of the IGFBP3 promoter
17803702 IGFBP-3 were unrelated to carotid intima-media thickness.
17763192 Perturbations in the IGF/IGFBP-3 axis may be potential additional targets for pharmacological manipulation in coronary heart disease.
17761791 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17724372 Observational study of gene-disease association. (HuGE Navigator)
17724372 Serum levvels amd a single nucleotide polymorphism are indiative of prostate carcinogenesis.
17719815 IGFBP-3 sensitizes prostate cancer cells to interferon-gamma (IFN-gamma)-induced apoptosis and inhibition of cell proliferation
17689128 No significant differences in levels in fibromyalgia patients.
17668637 Men who carry the IGFBP3 C allele were found to have a higher risk of developing prostate cancer compared to controls, and the association was grade specific in both ethnic groups
17655506 [(125)I]-labeled IGFBP-2 and -3, but not IGFBP-1, were proteolyzed by Ca(2+)-activated m-calpain in vitro.
17635417 These results suggest that IGFBP3 might play an important role in the cellular senescence of human umbilical vein endothelial cells as well as in vivo aging.
17627014 Observational study of gene-disease association. (HuGE Navigator)
17624927 Insulin-like growth factor binding protein (IGFBP)-3 mRNA is more abundantly expressed in hypoxia-related inflammatory angiogenesis and recent in vivo data suggest that IGFBP-3 has direct, IGF-independent inhibitory effects on angiogenesis.
17597108 large prospective study showed no overall association between the insulin-like growth factor axis and prostate cancer risk, however, IGF-1:IGFBP-3 molar ratio was related to risk for aggressive prostate cancer in obese men
17593323 A 30-kDa proteolytic IGFBP-3 fragment was isolated from third trimester pregnancy human serum and identified by amino acid sequence analysis and mass spectrometry to correspond to residues 1-212 of the parent protein.
17577982 Studies show that the purify of recombinant IGFBP3 is over 95% and was identified by Western-blot.
17567756 IGFBP3 suppresses retinopathy through suppression of oxygen-induced vessel loss and promotion of vascular regrowth.
17566087 Observational study of gene-disease association. (HuGE Navigator)
17566087 Common genetic variation in IGFBP3 influences circulating levels of IGFBP-3 among African-Americans, Native Hawaiians, Japanese-Americans, Latinos, and whites.
17560154 Severely deficient in a case of insulin-resistance syndrome (Rabson-Mendenhall type).
17555512 Observational study of gene-disease association and pharmacogenomic / toxicogenomic. (HuGE Navigator)
17546465 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17457048 IGFBP-3 contributes to esophageal tumor development and progression through IGF-dependent and independent mechanisms.
17453001 Methylation of IGFBP3 may be involved in the early stages of prostate cancer development.
17447118 Serum testosterone concentration and serum IGF-1/IGFBP-3 molar ratio are the major determinants of bone mineral density in boys at different pubertal stages.
17446556 normal breast epithelial cells can induce apoptosis of breast cancer cells through IGFBP-3 and maspin.
17434920 IGFBP-3 and Nur77 associate in the cytoplasmic compartment in 22RV1 human prostate cancer cells.
17434446 The role of GalNAc-T14 as an intracellular mediator of the effects of IGFBP-3 need to be verified in future studies.
17396438 children with sickle cell anemia with poor growth had significantly more proteolyzed IGFBP-3 in serum compared to children with normal growth
17388800 IGFBP-3 induces angiogenesis through IGF-I- and SphK1-dependent mechanisms
17350302 Observational study of gene-disease association. (HuGE Navigator)
17300730 Observational study of gene-disease association. (HuGE Navigator)
17297462 CDX2 can function as a transcriptional repressor, and one mechanism by which CDX2 promotes anchorage-independent growth is by transcriptional repression of IGFBP-3.
17293864 Observational study of gene-disease association. (HuGE Navigator)
17289909 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17287408 protective role of IGFBP-3 in risk of breast cancer
17264182 Circulating low levels of total IGFBP-3 was associated with increased risk of incident coronary events in older adults.
17237715 IGFBP-3 has potent insulin-antagonizing capability and suggest a role for IGFBP-3 in cytokine-induced insulin resistance and other mechanisms involved in the development of type-2 diabetes.
17210081 the expression level of IGFBP3 in breast tissues may be involved in breast tumorigenesis
17187018 exposure to hypoxia and acidosis at birth strongly correlated with a fall in IGF-1 and IGFBP-3 levels in cord blood
17172410 results strongly suggest that IGFBP-3 expression may be a vital cell motility, migration, and proliferation factor necessary for melanoma metastasis and is an important biomarker in human melanoma
17119061 plasma levels of IGF1 and IGFBP-3 vary by ethnic group and have roles in development of obesity
17113753 circulating levels may be lowered in patients with head and neck cancer
17096329 Results showed that IGFBP-3 methylation played an important role in the silencing of its expression, suggesting that IGFBP-3 may act as a tumor suppressor gene in several human cancers examined.
17085968 These results suggest that caspase-10, DR-3 and IGFBP-3 are involved in apoptosis in the preeclamptic placenta.
17070193 High IGF-II, IGFBP-3, IGFBP-4, and low PAPP-A levels in FF at the time of oocyte retrieval suggest better oocyte maturation and early embryo development.
17063263 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17063263 polymorphisms in the IGF-1R and IGFBP3 genes, but not IGF-1 or IGFALS, may be associated with altered survival among subgroups of breast cancer patients defined by menopausal status
17056474 IGFBP-3, IGFBP-4, and IGFBP-10/CYR61 mRNA levels were up-regulated in Barrett's and tumour tissue of oesophageal adenocarcinoma patients
17051426 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
17051426 Genetic variation in IGFBP3 is associated with breast cancer risk
17047053 Cleavage of IGFBP-3 in breast carcinoma tissues was correlated with ADAM28 expression levels and inhibited by treatment with ADAM inhibitor or anti-ADAM28 antibody.
17044098 Observational study of gene-disease association. (HuGE Navigator)
17035411 Observational study of gene-disease association. (HuGE Navigator)
17035411 Common genetic variation in the IGFBP3 gene does not substantially influence prostate and breast cancer susceptibility.
17018785 Observational study of gene-disease association. (HuGE Navigator)
16969385 This study demonstrates a direct interaction of the IGF and TGF-beta systems in human renal carcinoma cells. The observations that IGF-I enhances the TGF-beta signaling and that TGF-beta promotes IGFBP-3 production
16965600 Low expression of IGFBP-3 is associated with hepatocellular carcinoma
16935391 High plasma levels of IGF-1, IGF-2, and IGFBP-3 were associated with good prognosis in patients with advanced NSCLC.
16915540 Blood level is not a marker for metabolic syndrome x.
16887362 A decrease in free insulin-like growth factor 1 and IGFBP-3 levels, along with increases in blood pressure, significantly influenced the presence of diabetic complications
16825320 a novel functional androgen response element is present in the IGFBP-3 promoter that directly mediates androgen induction of IGFBP-3 expression
16793770 IGFBP-3 can induce apoptosis in an IGF-independent manner without being secreted or concentrated in the nucleus
16776662 IGFBP-1, IGFBP-3 and IGF-I show acute changes following a glucose load and there are marked gender differences in these responses.
16775172 High levels of IGFBP-3 is associated with an increased risk of prostate cancer
16763062 results indicate a previously unrecognized and potentially important role for insulin-like growth factor binding protein 3(IGFBP-3) in the extracellular matrix
16723126 By Northern blot, we confirm hypoxia-induced expression of insulin-like growth factor binding protein 3 (igfbp3), thioredoxin-interacting protein (txnip), neuritin (nrn1).
16645643 Both addition of IGFBP-3 protein to cell cultures or enforced expression of IGFBP-3 in the HT29 colon carcinoma cell line inhibited nuclear factor kappa B (NF-kappaB) activation in response to the induction of apoptosis by TRAIL.
16617154 IGFBP-3 is a growth inhibitor molecule (news)
16614079 IGFBP-3 has positive or negative effects on growth and survival dependent upon the status of cholesterol-stabilized integrin receptor complexes
16552541 The IGFBP3, hRas, JunB, Egr-1, Id1 and MIDA1 genes were up-regulated in psoriatic involved skin compared with uninvolved skin.
16543235 there are several conserved residues in the IGFBP-5 N-terminal region that are critical for transactivation and IGFBP-2 and -3 also have strong transactivation activity in their N-domains
16541420 C4-2 cell survival in an androgen-depleted environment may be facilitated through differential resistance to the apoptotic effects elicited by IGFBP-3
16540651 an IGFBP-3 mutant with deleted leader sequence localizes within the nucleus, its abundance is regulated by the ubiquitin/proteasome pathway, nuclear IGFBP-3 can induce apoptosis
16489531 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
16489075 IGFBP-3 expression was higher in less aggressive tumors, but was not associated with disease progression.
16455777 Rpb3 is a potential nuclear target of insulin-like growth factor binding protein-3
16448675 Observational study of gene-disease association. (HuGE Navigator)
16404426 Observational study of gene-disease association. (HuGE Navigator)
16394092 IGF-I and IGFBP-3 levels were positively associated with weight gain and height gain from birth to 3 months in small for gestational weight versus appropriate weight children.
16322329 IGFBP-3 is differentially expressed between stromal and epithelial components of normal and malignant colon, which may reflect its pro-apoptotic, IGF-I-independent effect on colonic epithelial cells.
16306136 Observational study of gene-disease association. (HuGE Navigator)
16306136 IGF1 and IGFBP3 tagging polymorphisms are associated with circulating levels of IGF1, IGFBP3 and risk of breast cancer.
16275148 Using the rat insulinoma RINm5F cell line, we report the first studies in insulin-secreting cells that IGFBP-3 selectively suppresses multiple, key intracellular phosphorelays.
16215864 Observational study of gene-disease association. (HuGE Navigator)
16211216 IGFBP-3 mediates growth suppression signals via the TGF-beta and/or retinoblastoma protein pathways in hepatocellular carcinoma
16210470 insulin-like growth factor signaling is subject to negative regulation through IGF binding protein-3 and positive regulation by EGF
16189260 Impacts on insulin signaling pathway to Inhibited insulin-stimulated glucose uptake independent of IGFs and through nonnuclear mechanisms. inhibited insulin-stimulated glucose uptake in omental but not s.c. adipose tissue explants.
16189247 In diabetics, nonglycosylated IGFBP-3 is degraded more rapidly than glycosylated IGFBP-3. By acting as substrate for IGFBP-3 protease, nonglycosylated IGFBP-3 protects endogenous, glycosylated IGFBP-3 from degradation, allowing total IGFBP-3 to increase.
16181731 Loss of insulin-like growth factor-binding protein-3 expression is associated with head and neck carcinogenesis.
16049980 Observational study of gene-disease association. (HuGE Navigator)
16030120 Observational study of gene-disease association. (HuGE Navigator)
16015705 Imbalance of IGF-1 and IGFBP-3 may play a role in hepatocarcinogenesis and tumor development of liver cirrhosis patients
15987847 IGF BP3 was associated with birth weight as measured in seconsd semestser amniotic fluid.
15986122 Observational study of gene-disease association. (HuGE Navigator)
15986122 Increased breast cancer risk in women with promoter polymorphisms in IGF1 and IGFBP3 genes, with increased risk for individuals homozygous for both polymorphisms.
15959422 Maternal diabetes is not associated with suppressed levels of IGFBP-1 in cord serum.
15941947 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15927849 Preincubation of erythroid cells with thrombospondin 1 eliminated the inhibitory activity of IGFBP-3
15894694 Observational study of gene-disease association. (HuGE Navigator)
15894694 Finds IGFBP3 2133C variant allele associated with lower circulating IGFBP-3 hormone levels and an increased risk of colorectal cancer.
15894673 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
15844718 The level of intact IGFBP-3 is decreased in inflammatory bowel disease with moderate to severe disease activity. This decrease may be linked to altered IGFBP-3 production or to increased cleavage by proteases other than MMP-9.
15817480 IEE (IGFBP-3 enhancer element) is a positive transcription regulatory element that contributes to the up-regulation of IGFBP-3 during cellular senescence
15809062 PTEN may inhibit antiapoptotic IGF actions not only by blocking the IGF-IGFR-induced Akt activity, but also by regulating expression of components of the IGF system, in particular, upregulation of IGFBP-3
15802501 Although IGFBP-3 and IGFBP-5 share much structural and functional homology, they can modulate distinct apoptotic pathways in human breast cancer cells.
15800934 Observational study of gene-disease association. (HuGE Navigator)
15781645 IGFBP-3 is a target of transcriptional repression by DeltaNp63alpha and that this repression represents a mechanism by which tumors that overexpress p63 may be protected from apoptosis.
15769996 DNA damage and hypoxia are two important physiologic activators of p53.
15734965 Observational study of gene-disease association. (HuGE Navigator)
15703779 dysregulation of IGFBP-3 in patients with myelodysplastic syndromes
15681824 Insulin-like growth factor binding proteins 3 and 5 are xpressed in idiopathic pulmonary fibrosis and have a role in extracellular matrix deposition
15668470 Observational study of gene-disease association. (HuGE Navigator)
15661050 The expression of certain IGFBP is significantly altered in renal cell carcinoma
15651061 1,25-dihydroxyvitamin D3-induced up-regulation of IGFBP-3 is not required for the growth inhibitory effects of 1,25D in prostate cancer cells grown in serum-containing media.
15642732 plasminogen binds with high affinity to IGF-II and IGF-binding protein-3
15642160 Increased breast epithelial IGFBP-3 expression is a feature of tumorigenesis with cytoplasmic immunoreactivity in the absence of significant nuclear localisation in IDCs and DCIS; IGFBP-3 suggested to be a potential mitogen
15641264 Serum IGFBP-3 levels differed significantly between pubertal developmental stages.
15641262 IGFBP-3 levels decreased significantly six months after the iodine supplementation.
15625284 Increased circulating IGF-1 and IGFBP-3 may be stimulators of atherosclerosis.
15517912 The serum IGF-1 and IGFBP-3 levels were significantly elevated in esophageal cancer patients and there was a positive correlation between IGF-1 and IGFBP-3.
15485880 N- and C-terminal residues of IGFBP-3 have roles in regulating IGF complex formation and receptor activation
15448002 Met proto-oncogene and insulin-like growth factor binding protein 3 have roles in metastasis of well-differentiated pancreatic endocrine neoplasms
15379965 Mutation analysis in patients with undescended testis revealed functionally deleterious mutations, which may be responsible for the abnormal phenotype in some of the patients. (review)
15302288 Long-term use of both conjugated equine etrogens and raloxifene decreases serum IGF-I and the IGF-I/IGFBP-3 ratio, but raloxifene increases ISGFBP-3.
15298948 Observational study of gene-disease association. (HuGE Navigator)
15298948 IGFBP3 polymorphism maybe associated with the level of blood IGFBP3 protein and an increase risk of breast cancer.
15282325 These findings identify the repression of insulin-like growth factor binding protein 3 gene by EWS/FLI-1 as a key event in the development of Ewing's sarcoma.
15247904 interference with Sp-1 transactivation by MeCP2 may contribute to the transcriptional defect of IGFBP-3 expression in NSCLC cells with methylated promoter
15247132 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
15247132 the IGFBP3 variants was not associated independently with colon cancer, but there was an association when examined with IRS1. The risk increased 70%.
15221971 Association between high IGF-I and IGFBP-3 levels and increased risk of breast cancer in premenopausal women.
15198293 Patients with typical Sotos syndrome show low plasma IGF-II, IGFBP-3, IGFBP-4, and increased proteolysis of IGFBP-3 in serum.
15178549 endogenous IGFBP-3 directly inhibits proliferation of human intestinal smooth muscle cells by activation of TGF-betaRI and Smad2, an effect that is independent of its effect on IGF-I-stimulated growth.
15140235 Reduced expression of IGFBP-3 in recessive dystrophic epidermolysis bullosa squamous cell carcinoma may provide a partial explanation for the aggressive behavior and poor prognosis of these tumors in this genodermatosis.
15126567 Pregnancy-proteolyzed IGFBP-3, despite forming normal ternary complexes, is less effective than intact IGFBP-3 in retarding IGF egress from the circulation.
15086466 Renal cell carcinoma (RCC) expresses IGF-I and IGFBP-3 and is responsive to exogenous IGF-I stimulation. In metastatic RCC, autocrine IGF-I and IGFBP-3 stimulated and inhibited growth. IGF-I and IGFBP-3 possible treatment in advanced RCC.
15070968 Interaction between IGFBP-3 and EGF receptor system is central to whether IGFBP-3 acts as growth stimulator or inhibitor in breast cancer cells. Therapies targeting EGFR may have increased efficacy in breast tumors expressing high levels of IGFBP-3.
15069073 IGFBP-3 is phosphorylated by tissue transglutaminase 2
15067329 Down-regulation of IGFBP-3 gene expression is associated with Prostatic Neoplasms
15066922 Observational study of gene-disease association. (HuGE Navigator)
15047131 Following severe burn, a shift occurs toward a predominant Th2 phenotype. Exogenous IGF-I/IGFBP-3 treatment partially reverses this response.
15014034 an important additional prognostic marker in serum in ovarian cancer
14751238 IGFBP-3 directly triggers a specific intracellular signal in MCF-7 cells
14744783 IGFBP-3 plays a crucial role in regulating IGF-I bioavailability, promoting cell survival.
14710345 an apparent altered regulation of local IGFBP-3 production during malignancy
14693733 Observational study of gene-disease association. (HuGE Navigator)
14674122 breast malignant explants showed the progesterone induced IGFBP-3/IGF-I index decrease; the decrease was most evident in malignant explants expressing progesterone receptor
14644829 IGFBP-3 mRna expression is increased in endometriosis, compared to normal endomatrium.
14598881 Upregulated with exposure to bone microenvironment and linked to TGF-beta mediated cell proliferaton
14597676 LRP1 is the type V TGF-beta receptor and mediates growth inhibition by IGFBP-3
14576164 Actions of IGFBP-3 are mediated by internalization via distinct endocytic pathways.
14576163 The metal-binding domain of IGFBP3 mediate cellular uptake and modulates apoptosis.
14561895 functional effects of Humanin-IGFBP-3 interaction on cell survival and apoptosis
12962157 IGFBP-3 can bind to LTBP-1 and provide a potential mechanism whereby IGFBP-3 can interact with the TGF-beta system
12937269 IGFBP-3 degrading by MMP might have widespread consequences for the behavior of epidermal keratinocytes.
12926118 During Tamoxifen treatment, IGFBP-3 proteolysis was increased in breast cancer.
12925957 Observational study of gene-disease association. (HuGE Navigator)
12925957 Polymorphic variation in IGFBP3 is associated with breast cancer risk.
12907612 Observational study of gene-disease association. (HuGE Navigator)
12907612 The IGFBP-3 -202 A/C polymorphism was not associated with susceptibility to prostate cancer.
12870155 endurance training improves glucose disposal and increases insulin-like growth binding protein-1 and -3 in men
12865482 Divergent influences of sex steroids, IGF-1, and IGFBP3 on age-related changes in lean body mass in healthy elderly men and women.
12810533 isolated amino-terminal and carboxyl-terminal domains of IGFBP-3 cooperate in the presence of IGFs to form high-affinity complexes that retain the ability to block IGF activity.
12725526 IGFBP-3 mRNA and protein are differentially expressed in distinct human brain microvascular endothelial cells populations.
12599210 IGFBP-3 supports myoblast differentiation
12590636 Augmented serum levels of the IGF-I/IGF-binding protein-3 ratio in pre-menopausal patients with type I breast cysts.
12571851 quantities of IGFBP-3 produced in culture by human cartilage are small compared with the amount supplied in the form of "small complexes" from the circulation
12571183 Follicular fluid IGF-1 and IGFBP-3 levels were not significantly different among the groups; however, follicular fluid IGFBP-1 levels were lower in those patients with moderate/severe endometriosis
12519841 data demonstrate for the first time that serum levels of IGFs (including free fractions) and IGFBPs are not increased in euthyroid Graves' patients with active thyroid eye disease
12508918 IGFBP-3 concentration significantly lower in acute ischemic stroke than in controls.
12473575 Hypermethylation of IGFBP-3 promoter is associated with non-small cell lung cancer
12242693 role in breast cancer cell growth - review
12220677 These results provide evidence that a specific intracellular signal is triggered by IGFBP-3 binding to a cell surface receptor.
12219010 HT29 tumor cell proliferation in vitro was due, at least in part, to surgery-related depletion of insulin-like growth factor binding protein 3 in peripheral blood.
12213898 improves insulin resistance by GH-dependent and independent mechanisms
12210764 Variable mid-region is responsible for the specific pro-apoptotic functions of IGFBP-3; phosphorylation may provide a mechanism for regulation of this action
12200149 IGFBP-3 promoter is activated by Trichostatin A-upregulated Sp1
12163384 expression increases during immortalization of cervical keratinocytes
12150454 high levels of IGFBP-3 predicted distant recurrence but not death in postmenopausal breast cancer patients and those with estrogen receptor-positive tumors
12135130 circulating level of IGFBP3 is related to the extent of myocardial injury in patients with hypertrophic cardiomyopathy.
12122101 Insulin-like growth factor-I (IGF-I) and IGF binding protein-3 as predictors of advanced-stage prostate cancer.
12111701 is inversely associated with benign prostatic hyperplasia risk
12068000 Insulin-like growth factor binding protein-3 inhibits the growth of non-small cell lung cancer.
12054563 The amino-terminal region induces apoptosis of MCF-7 breast carcinoma cells.
12051736 Enhanced expression in gastric cancer cells increases paclitaxel and etoposide-induced growth inhibition
12011225 Insulin-like growth factor I, IGF-binding protein 3, and lung cancer risk in a prospective study of men in China.
12006706 determination of blood levels in adult patients with severe liver disease before and after orthotopic liver transplantation
11997031 identification of the proteolytic cleavage sites in circulating IGFBP-3
11971816 IGFBP-3 is essential for TNF-alpha-induced apoptosis in PC-3 cells
11959812 A possible role for insulin-like growth factor-binding protein-3 autocrine/paracrine loops in controlling hepatocellular carcinoma cell proliferation
11953210 study the changes of plasma insulin-like growth factor -1 (IGF-1) and IGF binding protein 3 (IGFBP3) in patients with acute cerebral infarct (ACI) and acute cerebral hemorrhage (ACH)
11948969 induces early apoptosis and has potential tumor suppressive effects in prostate cancer
11940579 Insulin-like growth factor-binding protein-3 activates a phosphotyrosine phosphatase
11914026 Total and free insulin-like growth factor I, insulin-like growth factor binding protein 3 and acid-labile subunit reflect clinical activity in acromegaly.
11914023 Reduced serum insulin-like growth factor-1 (IGF-1) and IGF-binding protein-3 levels in adults with inflammatory bowel disease.
11886859 interaction with STAT-1 during chondrogenesis
11804742 The upstream AP2-binding site of IGFBP3's promoter is specifically hypermethylated in hepatomas.
11784719 Insulin-like growth factor (IGF)-binding protein-3 mutants that do not bind IGF-I or IGF-II stimulate apoptosis in human prostate cancer cells
11762714 Hypothyroidism is associated with significant reductions of IGFBP-3
11751851 This study defines a signaling pathway for IGFBP-3 from a cell surface receptor to nuclear transcriptional activity, requiring TGF-betaRII but not dependent on the nuclear translocation of IGFBP-3
11319179 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
11238520 Observational study of gene-disease association. (HuGE Navigator)
7566179 p53 induces the growth inhibitor IGF-binding protein 3 in apoptosis.

AA Sequence

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCC      1 - 70
LTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASES     71 - 140
EEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY    141 - 210
GPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGK    211 - 280
EDVHCYSMQSK                                                               281 - 291
//

Text Mined References (605)

PMID Year Title
27071409 2016 Associations of Insulin and IGFBP-3 with Lung Cancer Susceptibility in Current Smokers.
26975989 2016 Pancreatic cancer cell-derived IGFBP-3 contributes to muscle wasting.
26902691 2016 Metformin may protect nondiabetic breast cancer women from metastasis.
26893016 2016 Circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3 and terminal duct lobular unit involution of the breast: a cross-sectional study of women with benign breast disease.
26731648 2016 Improving the Prediction of Prostate Cancer Overall Survival by Supplementing Readily Available Clinical Data with Gene Expression Levels of IGFBP3 and F3 in Formalin-Fixed Paraffin Embedded Core Needle Biopsy Material.
26670461 2015 Insulin-like growth factor binding protein-3 is a new predictor of radiosensitivity on esophageal squamous cell carcinoma.
26637371 2015 The participation of insulin-like growth factor-binding protein 3 released by astrocytes in the pathology of Alzheimer's disease.
26540630 2015 Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells by requirement of integrin ?1.
26388613 2015 Circulating levels of IGF-1, IGFBP-3, and IGF-1/IGFBP-3 molar ratio and colorectal adenomas: A meta-analysis.
26378048 2015 Involvement of p53 in insulin-like growth factor binding protein-3 regulation in the breast cancer cell response to DNA damage.
26349977 2015 Polymorphisms of insulin-like growth factor binding protein-3 as a predictor for risk and patient survival in esophageal squamous cell carcinoma.
26216267 2015 Humanin Peptide Binds to Insulin-Like Growth Factor-Binding Protein 3 (IGFBP3) and Regulates Its Interaction with Importin-?.
26121987 2015 A prospective study of insulin-like growth factor 1, its binding protein 3, and risk of endometriosis.
26091039 2015 A Single Kinase Generates the Majority of the Secreted Phosphoproteome.
26074086 2015 Nuclear actions of insulin-like growth factor binding protein-3.
26069074 2015 Circulating insulin-like growth factor binding protein-3 predicts one-year outcome after ischemic stroke.
26068014 2015 The Circulating IGF System in Hepatocellular Carcinoma: The Impact of Liver Status and Treatment.
26063735 2015 The p53 family member p73 modulates the proproliferative role of IGFBP3 in short children born small for gestational age.
25987030 2015 Insulin-like Growth Factor-1, IGF-binding Protein-3, C-peptide and Colorectal Cancer: a Case-control Study.
25966104 2015 IGFBP-3 A-202C and C2133G polymorphisms and colorectal cancer risk: a meta-analysis of case-control studies.
25960224 2015 Impact of the IGFBP3 A-202C polymorphism on susceptibility and clinicopathologic features of breast cancer.
25947142 2015 Circulating IGF1 and IGFBP3 in relation to the development of ?-cell autoimmunity in young children.
25945837 2015 Insulin-like growth factor binding protein-3 inhibits cell adhesion via suppression of integrin ?4 expression.
25822686 2016 IGFBP-3 Gene Methylation in Primary Tumor Predicts Recurrence of Stage II Colorectal Cancers.
25742716 2015 The growth hormone receptor exon 3-deleted/full-length polymorphism and response to growth hormone therapy in prepubertal idiopathic short children.
25739014 2015 A pleiotropic effect of the single clustered hepatic metastamiRs miR-96-5p and miR-182-5p on insulin-like growth factor II, insulin-like growth factor-1 receptor and insulin-like growth factor-binding protein-3 in hepatocellular carcinoma.
25662950 2015 Insulin-like growth factor binding protein-3 enhances etoposide-induced cell growth inhibition by suppressing the NF-?B activity in gastric cancer cells.
25619494 2015 Differences in IGF-axis protein expression and survival among multiethnic breast cancer patients.
25556430 2014 Induction of apoptosis by IGFBP3 overexpression in hepatocellular carcinoma cells.
25553725 2014 Association of the insulin-like growth factor binding protein 3 (IGFBP-3) polymorphism with longevity in Chinese nonagenarians and centenarians.
25552351 2015 Influence of growth hormone receptor (GHR) exon 3 and -202A/C IGFBP-3 genetic polymorphisms on clinical and biochemical features and therapeutic outcome of patients with acromegaly.
25548030 2015 Insulinlike Growth Factor-1 and Its Binding Protein-3 Polymorphisms Predict Circulating IGF-1 Level and Appendicular Skeletal Muscle Mass in Chinese Elderly.
25525174 2014 Pioglitazone restores IGFBP-3 levels through DNA PK in retinal endothelial cells cultured in hyperglycemic conditions.
25482372 2014 Methylation status of IGFBP-3 as a useful clinical tool for deciding on a concomitant radiotherapy.
25449421 2015 Involvement of insulin-like growth factor binding protein-3 in peroxisome proliferator-activated receptor gamma-mediated inhibition of breast cancer cell growth.
25385818 2015 Analysis of IGF(CA)19 and IGFBP3-202A/C gene polymorphisms in patients with acromegaly: association with clinical presentation and response to treatments.
25385317 2016 Increased Igf-I/Igfbp-3 Ratios in Postmenopausal Taiwanese with Breast Cancer, Irrespective of Er and Pr Statuses and Her2 Expression in a Case-Control Study.
25295265 2014 IGF-1 and ADMA levels are inversely correlated in nondiabetic ankylosing spondylitis patients undergoing anti-TNF-alpha therapy.
25285521 2014 Genetic and dietary determinants of insulin-like growth factor (IGF)-1 and IGF binding protein (BP)-3 levels among Chinese women.
25277046 2015 Targeted mass spectrometry analysis of the proteins IGF1, IGF2, IBP2, IBP3 and A2GL by blood protein precipitation.
25179796 2015 Decreased IGF-1 concentration during the first trimester of pregnancy in women with normal somatotroph function.
25127039 2014 IGFBP3 methylation is a novel diagnostic and predictive biomarker in colorectal cancer.
25120154 2015 Women with osteoarthritis have elevated synovial fluid levels of insulin-like growth factor (IGF)-1 and IGF-binding protein-3.
25108383 2014 Genome-wide association analyses identify variants in developmental genes associated with hypospadias.
25086184 2014 IGFBP-3 inhibits TNF-? production and TNFR-2 signaling to protect against retinal endothelial cell apoptosis.
25081695 2014 Expression and underlying roles of IGFBP-3 in paclitaxel-treated gastric cancer SGC-7901 cells.
25059666 2014 MicroRNA-21 promotes glioblastoma tumorigenesis by down-regulating insulin-like growth factor-binding protein-3 (IGFBP3).
25028991 2015 Order effects of combined strength and endurance training on testosterone, cortisol, growth hormone, and IGF-1 binding protein 3 in concurrently trained men.
24953254 2014 IGFBP-3: a cell fate pivot in cancer and disease.
24943688 2014 Clinical significance of serum insulin-like growth factor-1 (IGF-1) and insulin-like growth factor binding protein-3 (IGFBP-3) in patients with breast cancer.
24942865 2014 Transcriptional and posttranslational regulation of insulin-like growth factor binding protein-3 by Akt3.
24938707 2014 Insulin-like growth factor binding protein-3 (IGFBP-3) genetic variant and the risk of esophageal squamous cell carcinoma in a Chinese population.
24928840 2015 Genome-wide association and functional studies identify a role for IGFBP3 in hip osteoarthritis.
24926947 2014 Ternary complex formation and IGFBP-3 proteolytic activity during childhood: age-dependent changes.
24915949 2014 Expression of insulin-like growth factors in the placenta in preeclampsia.
24905466 2014 Insulin-like-growth-factor-binding-protein-3 (IGFBP-3) contrasts melanoma progression in vitro and in vivo.
24878287 2014 STAT-1 expression is regulated by IGFBP-3 in malignant glioma cells and is a strong predictor of poor survival in patients with glioblastoma.
24825082 2014 Serum insulin-like growth factor-binding protein-3 level correlated with glycemic control and lipid profiles in children and adolescents with type 1 diabetes.
24811788 2014 Epigenetic dysregulation of the IGF system in placenta of newborns exposed to maternal impaired glucose tolerance.
24809065 2014 Maximal oxygen uptake is associated with allele -202 A of insulin-like growth factor binding protein-3 (IGFBP3) promoter polymorphism and (CA)n tandem repeats of insulin-like growth factor IGF1 in Caucasians from Poland.
24785566 2014 Early infant growth is associated with the risk of islet autoimmunity in genetically susceptible children.
24587638 2014 Possible roles of insulin, IGF-1 and IGFBPs in initiation and progression of colorectal cancer.
24586243 2014 Genetic polymorphisms in IGF-I and IGFBP-3 are associated with prostate cancer in the Chinese population.
24464126 2014 Lack of association of IGFBP-3 gene polymorphisms with colorectal cancer: evidence from 17,380 subjects.
24457161 2014 IGFBP-3 promoter polymorphism -202A>C (rs2854774) contributes to prostate cancer risk: evidence based on 9,482 subjects.
24451943 2014 Role of polymorphisms of the IGF2 and IGFBP3 genes and risk of gastric carcinoma in China.
24386080 2013 IGFBP3, a transcriptional target of homeobox D10, is correlated with the prognosis of gastric cancer.
24379526 2013 Gene expression of IGF1, IGF1R, and IGFBP3 in epiretinal membranes of patients with proliferative diabetic retinopathy: preliminary study.
24368776 2014 Insulin-like growth factor I, insulin-like growth factor binding protein 3, and atrial fibrillation in the elderly.
24351920 2013 Expression of the IGF-1, IGFBP-3 and IGF-1 receptors in dental pulp stem cells and impacted third molars.
24339922 2013 Role of IGF-binding protein 3 in the resistance of EGFR mutant lung cancer cells to EGFR-tyrosine kinase inhibitors.
24337110 2014 Inhibition of insulin-like growth factor-binding protein-3 signaling through sphingosine kinase-1 sensitizes triple-negative breast cancer cells to EGF receptor blockade.
24310658 2014 IGF1(CA)19 and IGFBP-3-202A/C gene polymorphism and cancer risk: a meta-analysis.
24175768 2013 Is there an association between variants in candidate insulin pathway genes IGF-I, IGFBP-3, INSR, and IRS2 and risk of colorectal cancer in the Iranian population?
24094144 2014 Associations of serum insulin-like growth factor-I and insulin-like growth factor-binding protein 3 levels with biomarker-calibrated protein, dairy product and milk intake in the Women's Health Initiative.
24051179 2013 Detection and identification of oxidized insulin-like growth factor-binding proteins and receptors in patients with colorectal carcinoma.
24022308 2013 Comparison of growth hormone receptor, igf-1r and igfbp-3 between tumoral and non-tumoral areas in non-melanoma skin cancers.
23962053 2013 IGF-1 receptor and IGF binding protein-3 might predict prognosis of patients with resectable pancreatic cancer.
23878061 2013 SND1 affects proliferation of hepatocellular carcinoma cell line SMMC-7721 by regulating IGFBP3 expression.
23864804 2013 Adipokines, insulin-like growth factor binding protein-3 levels, and insulin sensitivity in women with polycystic ovary syndrome.
23831640 2013 TGF-?-induced expression of IGFBP-3 regulates IGF1R signaling in human osteosarcoma cells.
23792502 2013 Insulin-like growth factor I correlates with MELD and returns to normal level after liver transplantation.
23789983 2013 Interactions between vitamin D and IGF-I: from physiology to clinical practice.
23784592 2013 The insulin-like growth factor-1 and expression of its binding protein?3 in chronic hepatitis C and hepatocellular carcinoma.
23770368 2013 Insulin-like growth factor binding protein-3 modulates osteoblast differentiation via interaction with vitamin D receptor.
23748063 2013 Impact of insulin resistance on insulin-like growth factor-1/insulin like growth factor-binding protein-3 axis and on early weight gain in small for gestational age infants.
23720424 2013 Stromal insulin-like growth factor binding protein 3 (IGFBP3) is elevated in the diseased human prostate and promotes ex vivo fibroblast-to-myofibroblast differentiation.
23619263 IGF-I and IGFBP-3 serum levels in patients hospitalized for complications of liver cirrhosis.
23611528 2013 Insulin-like Growth Factor I and its binding protein 3 in sepsis.
23592916 2013 Insulin-like growth factor binding protein-3 inhibits monocyte adhesion to retinal endothelial cells in high glucose conditions.
23527725 Expression of ADAM28 and IGFBP-3 genes in patients with colorectal cancer - a preliminary report.
23527244 2013 Meta-analysis of the association between insulin-like growth factor binding protein 3 genetic polymorphisms and colorectal cancer susceptibility.
23498137 2013 Tobacco specific carcinogen 4-(methylnitrosamino)-1-(3-pyridyl)-1-butanone suppresses a newly identified anti-tumor IGFBP-3/IGFBP-3R system in lung cancer cells.
23473966 2013 Serum but not cerebrospinal fluid levels of insulin-like growth factor-I (IGF-I) and IGF-binding protein-3 (IGFBP-3) are increased in Alzheimer's disease.
23464449 2012 Prostate cancer risk in relation to a single nucleotide polymorphism in the insulin-like growth factor-binding protein-3 (IGFBP3) gene: a meta-analysis.
23383064 2013 IGFBP-3 inhibits cytokine-induced insulin resistance and early manifestations of atherosclerosis.
23377640 2013 Common genetic variation and antidepressant efficacy in major depressive disorder: a meta-analysis of three genome-wide pharmacogenetic studies.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
23348700 2013 A novel antitumor activity of deguelin targeting the insulin-like growth factor (IGF) receptor pathway via up-regulation of IGF-binding protein-3 expression in breast cancer.
23341348 2013 Insulin-like growth factor pathway genes and blood concentrations, dietary protein and risk of prostate cancer in the NCI Breast and Prostate Cancer Cohort Consortium (BPC3).
23185474 2012 Association between circulating levels of IGF-1 and IGFBP-3 and lung cancer risk: a meta-analysis.
23178489 2014 The role of insulin-like growth factor binding protein-3 in the breast cancer cell response to DNA-damaging agents.
23174226 2013 The influence of promoter -202 A/C polymorphism (rs2854744) of the IGFBP-3 gene on erectile dysfunction risk and serum levels of IGF-I and IGFBP-3.
23158139 2012 Association of sterol regulatory element binding protein 2 and insulin-like growth factor binding protein 3 genetic polymorphisms with avascular necrosis of the femoral head in the Chinese population.
23041555 2013 Insulin-like factor binding protein-3 promotes the G1 cell cycle arrest in several cancer cell lines.
23036517 2012 Functional relationship between high mobility group A1 (HMGA1) protein and insulin-like growth factor-binding protein 3 (IGFBP-3) in human chondrocytes.
23011725 2013 IGFBP-3 nuclear localization predicts human prostate cancer recurrence.
22951368 2012 Cord blood triglycerides are associated with IGF-I levels and contribute to the identification of growth-restricted neonates.
22936258 2012 Ghrelin concentration is correlated with IGF-I/IGFBP-3 molar ratio but not with GH secretion in children with short stature.
22894543 2012 Genetic variability in IGF-1 and IGFBP-3 and body size in early life.
22892437 2012 Glycemic load effect on fasting and post-prandial serum glucose, insulin, IGF-1 and IGFBP-3 in a randomized, controlled feeding study.
22884472 2012 Posttranslational modifications of the insulin-like growth factor-binding protein 3 in patients with type 2 diabetes mellitus assessed by affinity chromatography.
22882716 2012 Association between the insulin-like growth factor axis in serum and periodontitis in the Study of Health in Pomerania: an exploratory study.
22879989 2012 FOXA1 promotes tumor progression in prostate cancer via the insulin-like growth factor binding protein 3 pathway.
22847383 2013 Associations of insulin-like growth factor and insulin-like growth factor binding protein-3 with mortality in women with breast cancer.
22801219 2012 IGFBP-3 sensitizes antiestrogen-resistant breast cancer cells through interaction with GRP78.
22778398 2012 Plasminogen activator inhibitor 1--insulin-like growth factor binding protein 3 cascade regulates stress-induced senescence.
22751133 2013 IGFBP-3 binds GRP78, stimulates autophagy and promotes the survival of breast cancer cells exposed to adverse microenvironments.
22745191 2012 The HMGA1-IGF-I/IGFBP system: a novel pathway for modulating glucose uptake.
22739332 2012 Influence of polymorphisms in genes encoding for insulin-like growth factor (IGF)-I, insulin, and IGF-binding protein (IGFBP)-3 on IGF-I, IGF-II, and IGFBP-3 levels in umbilical cord plasma.
22643116 2013 Expression of insulin-like growth factor II mRNA-binding protein 3 in squamous cell carcinomas of the head and neck.
22565227 2012 Genetic variants in IGF-I, IGF-II, IGFBP-3, and adiponectin genes and colon cancer risk in African Americans and Whites.
22554827 2012 Insulin-like growth factor axis and risk of type 2 diabetes in women.
22543588 2013 IGFBP-3 methylation-derived deficiency mediates the resistance to cisplatin through the activation of the IGFIR/Akt pathway in non-small cell lung cancer.
22527168 2012 A cross-sectional analysis of the association between diet and insulin-like growth factor (IGF)-I, IGF-II, IGF-binding protein (IGFBP)-2, and IGFBP-3 in men in the United Kingdom.
22500655 2012 High insulin-like growth factor mRNA-binding protein 3 (IMP3) protein expression is associated with poor survival in muscle-invasive bladder cancer.
22494072 2012 Insulin-like growth factor binding protein-3 suppresses vascular endothelial growth factor expression and tumor angiogenesis in head and neck squamous cell carcinoma.
22475139 2012 [Expression and significance of insulin-like growth factor-1 and insulin-like growth factor binding protein-3 in hepatocyte steatosis model].
22442270 2012 Decline in circulating insulin-like growth factors and mortality in older adults: cardiovascular health study all-stars study.
22441125 2012 Colocalization and identification of interaction sites between IGFBP-3 and GalNAc-T14.
22415807 2012 Functional polymorphisms in the insulin-like binding protein-3 gene may modulate susceptibility to differentiated thyroid carcinoma in Caucasian Americans.
22415309 2012 Hypoxia induces IGFBP3 in esophageal squamous cancer cells through HIF-1?-mediated mRNA transcription and continuous protein synthesis.
22389159 2012 The overexpression of IGFBP-3 is involved in the chemosensitivity of esophageal squamous cell carcinoma cells to nimotuzumab combined with cisplatin.
22381038 2012 Association between endometriosis and polymorphisms in insulin-like growth factor binding protein genes in Korean women.
22363400 2012 Maternal and fetal placental growth hormone and IGF axis in type 1 diabetic pregnancy.
22347413 2012 Smoking, green tea consumption, genetic polymorphisms in the insulin-like growth factors and lung cancer risk.
22332214 2012 Association of IGF1 gene haplotypes with high myopia in Chinese adults.
22328165 2012 Association of IGF-I and the IGF-I/IGFBP-3 ratio with plasma aldosterone levels in the general population.
22318747 2012 Functional and total IGFBP3 for the assessment of disorders of the GH/IGF1 axis in children with chronic kidney disease, GH deficiency, or short stature after SGA status at birth.
22278433 2012 The interactive effect of GHR-exon 3 and -202 A/C IGFBP3 polymorphisms on rhGH responsiveness and treatment outcomes in patients with Turner syndrome.
22253890 2012 Associations of insulin and insulin-like growth factors with physical performance in old age in the Boyd Orr and Caerphilly studies.
22246875 2012 Impaired expression of insulin-like growth factor-1 system in skeletal muscle of amyotrophic lateral sclerosis patients.
22167391 2012 Low expression of IGFBP-3 predicts poor prognosis in patients with esophageal squamous cell carcinoma.
22128038 2012 Significance of molecular markers in survival prediction of oral squamous cell carcinoma.
22113073 2012 Associations of IGF1 and its binding proteins with abdominal aortic aneurysm and aortic diameter in older men.
22085490 2012 Insulin-like growth factor binding protein-3 inhibits migration of endometrial cancer cells.
22032863 2012 Reference values for serum levels of insulin-like growth factor-I and insulin-like growth factor binding protein-3 in Korean children and adolescents.
22026507 2012 Association of the (CA)n repeat polymorphism of insulin-like growth factor-I and -202 A/C IGF-binding protein-3 promoter polymorphism with adult height in patients with severe growth hormone deficiency.
22004906 2012 IGF1 and IGFBP3 in acute respiratory distress syndrome.
22001433 2011 Regulation of IGFBP3 gene expression in short children born small for gestational age.
21944866 2011 Common polymorphisms in the GH/IGF-1 axis contribute to growth in extremely tall subjects.
21930730 2012 Association of insulin and insulin-like growth factors with Barrett's oesophagus.
21898383 2012 Increase in circulating levels of IGF-1 and IGF-1/IGFBP-3 molar ratio over a decade is associated with colorectal adenomatous polyps.
21892705 2012 Urinary bladder cancer risk in relation to a single nucleotide polymorphism (rs2854744) in the insulin-like growth factor-binding protein-3 (IGFBP3) gene.
21852217 2012 Insulin-like growth factor axis gene polymorphisms modify risk of pancreatic cancer.
21823995 2011 Gene expression patterns of insulin-like growth factor 1, insulin-like growth factor 2 and insulin-like growth factor binding protein 3 in human placenta from pregnancies with intrauterine growth restriction.
21788435 2011 Concentrations of IGF-I and IGFBP-3 and brain tumor risk in the European Prospective Investigation into Cancer and Nutrition.
21761353 2010 Circulating insulin-like growth factor (IGF)-I and IGF binding protein (IGFBP)-3 levels and postmenopausal breast cancer risk in the prostate, lung, colorectal, and ovarian cancer screening trial (PLCO) cohort.
21737444 2011 Involvement of insulin-like growth factor-binding protein-3 in the effects of histone deacetylase inhibitor MS-275 in hepatoma cells.
21701930 2012 Molecular profiling of direct xenograft tumors established from human pancreatic adenocarcinoma after neoadjuvant therapy.
21698457 2011 Serum insulin-like growth factor-I and insulin-like growth factor binding protein-3 levels with risk of malignant melanoma.
21697095 2011 Bone morphogenetic protein-1 processes insulin-like growth factor-binding protein 3.
21648284 2011 Evidence of insulin-like growth factor binding protein-3 proteolysis during growth hormone stimulation testing.
21636299 2011 IGF-I-IGFBP-3-acid-labile subunit (ALS) complex in children and adolescents with classical congenital adrenal hyperplasia due to 21-hydroxylase deficiency (CAH).
21585623 2011 Insulin-like growth factor (IGF)-I and IGF-binding protein-3 serum levels in relapsing-remitting and secondary progressive multiple sclerosis patients.
21562710 2011 Genotypes and phenotypes of IGF-I and IGFBP-3 in breast tumors among Chinese women.
21551235 2011 Antiangiogenic antitumor activities of IGFBP-3 are mediated by IGF-independent suppression of Erk1/2 activation and Egr-1-mediated transcriptional events.
21536469 2011 Relationship of insulin-like growth factor (IGF) binding protein-3 (IGFBP-3) gene polymorphism with the susceptibility to development of prostate cancer and influence on serum levels of IGF-I, and IGFBP-3.
21536375 2011 Insulin-like growth factor-binding protein-3 suppresses tumor growth via activation of caspase-dependent apoptosis and cross-talk with NF-?B signaling.
21529443 2011 Insulin-like growth factor binding protein-3 interacts with the thyroid hormone receptor ?1 and modulates transcription of thyroid hormone responsive gene.
21525788 2011 The insulin-like growth factor binding proteins 3 and 7 are associated with colorectal cancer and liver metastasis.
21521316 2011 Leptin is better than any other biological parameter for monitoring the efficacy of renutrition in hospitalized malnourished elderly patients.
21520165 2012 Preoperative insulin-like growth factor-binding protein-3 (IGFBP-3) blood level predicts gleason sum upgrading.
21520041 2012 Analysis of the cellular uptake and nuclear delivery of insulin-like growth factor binding protein-3 in human osteosarcoma cells.
21478207 2011 Serum concentrations of insulin-like growth factor-I, insulin-like growth factor binding protein-3 and cardiovascular risk factors in adolescents.
21474793 2011 Development of glycoprotein capture-based label-free method for the high-throughput screening of differential glycoproteins in hepatocellular carcinoma.
21471542 Association of IGF axis hormones with waist-to-hip ratio varies by physical activity.
21455575 2011 Up-regulation of insulin-like growth factor-binding protein 3 by 5-fluorouracil (5-FU) leads to the potent anti-proliferative effect of androgen deprivation therapy combined with 5-FU in human prostate cancer cell lines.
21447640 2011 Human IGF binding protein-3 overexpression impairs glucose regulation in mice via an inhibition of insulin secretion.
21447628 2011 Differential impacts of insulin-like growth factor-binding protein-3 (IGFBP-3) in epithelial IGF-induced lung cancer development.
21435441 2011 Novel protective properties of IGFBP-3 result in enhanced pericyte ensheathment, reduced microglial activation, increased microglial apoptosis, and neuronal protection after ischemic retinal injury.
21392749 2011 Evaluation of the insulin-like growth factors (IGF) IGF-I and IGF binding protein 3 in patients at high risk for breast cancer.
21388950 2011 Binding between insulin-like growth factor 1 and insulin-like growth factor-binding protein 3 is not influenced by glucose or 2-deoxy-D-glucose.
21383009 2011 Insulin-like growth factor-binding protein-3 (IGFBP-3) blocks the effects of asthma by negatively regulating NF-?B signaling through IGFBP-3R-mediated activation of caspases.
21378090 2011 Associations of IGF1 and IGFBPs 1 and 3 with all-cause and cardiovascular mortality in older men: the Health In Men Study.
21347663 2011 The association between bladder cancer and a single nucleotide polymorphism (rs2854744) in the insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) gene.
21254935 2011 Association between insulin-like growth factor binding protein-3 promoter polymorphism of -1590 C>A and lung cancer susceptibility in a Chinese Han population.
21216879 2011 A genome-wide association study identifies novel loci associated with circulating IGF-I and IGFBP-3.
21195059 2011 IGFBP3 and BAG1 enhance radiation-induced apoptosis in squamous esophageal cancer cells.
21140206 2011 IGFBP1 and IGFBP3 polymorphisms predict circulating IGFBP-3 levels among women from high-risk breast cancer families.
21078522 2011 Common genetic variation within IGFI, IGFII, IGFBP-1, and IGFBP-3 and endometrial cancer risk.
21076409 2010 Common variants in 22 loci are associated with QRS duration and cardiac ventricular conduction.
21068693 2011 IGF binding protein-3 treatment alters intestinal cell proliferation but not body weight of adult cystic fibrosis transmembrane conductance regulator deficient mice.
20945273 2010 Cervical scrapes levels of insulin-like growth factor-II and insulin-like growth factor binding protein 3 in women with squamous intraepithelial lesions and cervical cancer.
20921904 2011 Role of ghrelin and insulin-like growth factor binding protein-3 in the development of osteoporosis in inflammatory bowel disease.
20920870 2010 IGF(CA)19 and IGFBP-3-202A/C gene polymorphism in patients with acromegaly.
20889360 2010 Association of circulating IGF-I and IGFBP-3 concentrations and exercise capacity in healthy volunteers: results of the Study of Health in Pomerania.
20884247 Effect of the somatostatin analog octreotide acetate on circulating insulin-like growth factor-1 and related peptides in patients with non-metastatic castration-resistant prostate cancer: results of a phase II study.
20860465 2010 Host genetic variants in the IGF binding protein-3 impact on survival of patients with advanced gastric cancer treated with palliative chemotherapy.
20851879 2010 IGFBP-3 can either inhibit or enhance EGF-mediated growth of breast epithelial cells dependent upon the presence of fibronectin.
20848532 2011 Endogenous IGFBP-3 regulates excess collagen expression in intestinal smooth muscle cells of Crohn's disease strictures.
20810604 2010 Eighteen insulin-like growth factor pathway genes, circulating levels of IGF-I and its binding protein, and risk of prostate and breast cancer.
20801067 2010 Effect of high- and low-intensity exercise and metabolic acidosis on levels of GH, IGF-I, IGFBP-3 and cortisol.
20734064 2010 A large-scale candidate gene association study of age at menarche and age at natural menopause.
20731527 2011 A cross-sectional analysis of the associations between adult height, BMI and serum concentrations of IGF-I and IGFBP-1 -2 and -3 in the European Prospective Investigation into Cancer and Nutrition (EPIC).
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
20634197 2010 Comprehensive analysis of common genetic variation in 61 genes related to steroid hormone and insulin-like growth factor-I metabolism and breast cancer risk in the NCI breast and prostate cancer cohort consortium.
20628624 2010 Evaluation of candidate stromal epithelial cross-talk genes identifies association between risk of serous ovarian cancer and TERT, a cancer susceptibility "hot-spot".
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
20613589 2010 Elucidating mechanisms of osteogenesis in human adipose-derived stromal cells via microarray analysis.
20599318 2010 Transcriptional down-regulation of IGFBP-3 in human hepatocellular carcinoma cells is mediated by the binding of TIA-1 to its AT-rich element in the 3'-untranslated region.
20587610 2010 Examination of genetic polymorphisms in newborns for signatures of sex-specific prenatal selection.
20580999 2010 Body size, IGF and growth hormone polymorphisms, and colorectal adenomas and hyperplastic polyps.
20540360 2010 [A study of the single nucleotide polymorphism in seven genes (GHR, IGFBP3, IGFR1, IRS1, FMN1, ANXA2, TaGLN) in ethnic Russians and in patients with prostate cancer].
20513670 2010 Insulin-like growth factor-binding protein-3 promotes transforming growth factor-{beta}1-mediated epithelial-to-mesenchymal transition and motility in transformed human esophageal cells.
20501753 2010 Grade-specific expression of insulin-like growth factor-binding proteins-2, -3, and -5 in astrocytomas: IGFBP-3 emerges as a strong predictor of survival in patients with newly diagnosed glioblastoma.
20484221 2010 A comprehensive analysis of common IGF1, IGFBP1 and IGFBP3 genetic variation with prospective IGF-I and IGFBP-3 blood levels and prostate cancer risk among Caucasians.
20468064 2010 Association study of 182 candidate genes in anorexia nervosa.
20453000 2010 A Large-scale genetic association study of esophageal adenocarcinoma risk.
20427254 2010 Relationship between serum levels of insulin-like growth factors and subsequent risk of cancer mortality: findings from a nested case-control study within the Japan Collaborative Cohort Study.
20423985 2010 Bone mineral density acquisition in peripubertal female rhythmic gymnasts is directly associated with plasma IGF1/IGF-binding protein 3 ratio.
20416304 2010 Insulin-like growth factor axis gene polymorphisms and clinical outcomes in pancreatic cancer.
20403354 2010 A population-based study of IGF axis polymorphisms and the esophageal inflammation, metaplasia, adenocarcinoma sequence.
20378848 2010 Circulating insulin-like growth factor-1 and its binding protein-3: metabolic and genetic correlates in the community.
20357812 2010 Functional modulation of IGF-binding protein-3 expression in melanoma.
20353938 2010 Identification of a novel cell death receptor mediating IGFBP-3-induced anti-tumor effects in breast and prostate cancer.
20350746 2010 Influence of IGFBP3 gene polymorphisms on IGFBP3 serum levels and the risk of prostate cancer in low-risk Korean men.
20307522 2010 Alterations of insulin-like growth factor binding protein 3 (IGFBP-3) glycosylation in patients with breast tumours.
20302654 2010 Genotypes and haplotypes in the insulin-like growth factors, their receptors and binding proteins in relation to plasma metabolic levels and mammographic density.
20228135 2010 Nuclear export and mitochondrial and endoplasmic reticulum localization of IGF-binding protein 3 regulate its apoptotic properties.
20219400 2010 Insulin-like growth factor binding protein-3 gene methylation and protein expression in gastric adenocarcinoma.
20215856 2010 Genetic association of angiogenesis- and hypoxia-related gene polymorphisms with osteonecrosis of the femoral head.
20204283 2010 Prognostic significance of insulin growth factor-I receptor and insulin growth factor binding protein-3 expression in primary breast cancer.
20155489 2010 Common genetic variation of insulin-like growth factor-binding protein 1 (IGFBP-1), IGFBP-3, and acid labile subunit in relation to serum IGF-I levels and mammographic density.
20145156 2010 A 3'-untranslated region polymorphism in IGF1 predicts survival of non-small cell lung cancer in a Chinese population.
20144192 2010 Chromosome 7p linkage and association study for diabetes related traits and type 2 diabetes in an African-American population enriched for nephropathy.
20121533 2010 The relationship between maternal insulin-like growth factors 1 and 2 (IGF-1, IGF-2) and IGFBP-3 to gestational age and preterm delivery.
20119675 2010 Relationship of insulin-like growth factors system gene polymorphisms with the susceptibility and pathological development of hepatocellular carcinoma.
20102313 2010 Urinary excretion of IGFBP-1 and -3 correlates with disease activity and differentiates focal segmental glomerulosclerosis and minimal change disease.
20099974 2010 Serum level of IGFBP3 and IGF1/IGFBP3 molar ratio in addition to PSA and single nucleotide polymorphism in PSA and CYP17 gene may contribute to early diagnostics of prostate cancer.
20084546 2010 IGFBP3 A-202C polymorphism and breast cancer susceptibility: a meta-analysis involving 33,557 cases and 45,254 controls.
20051649 2010 Reference ranges for serum IGF-1 and IGFBP-3 levels in Chinese children during childhood and adolescence.
20039319 2010 IGF1, IGFBP1, and IGFBP3 genes and mammographic density: the Multiethnic Cohort.
20023704 2010 IGFBP-3 hypermethylation-derived deficiency mediates cisplatin resistance in non-small-cell lung cancer.
20003326 2009 Promoter methylation of IGFBP-3 and p53 expression in ovarian endometrioid carcinoma.
19960406 2010 Insulin-like growth factor binding protein-3 induces G1 cell cycle arrest with inhibition of cyclin-dependent kinase 2 and 4 in MCF-7 human breast cancer cells.
19948975 2009 Integrative predictive model of coronary artery calcification in atherosclerosis.
19944347 2009 Anthropometric correlates of insulin-like growth factor 1 (IGF-1) and IGF binding protein-3 (IGFBP-3) levels by race/ethnicity and gender.
19941883 2010 Maintenance of naïve CD8 T cells in nonagenarians by leptin, IGFBP3 and T3.
19938081 2009 Altered transmission of HOX and apoptotic SNPs identify a potential common pathway for clubfoot.
19919528 2009 Effects of endogenous insulin-like growth factor binding protein-3 on cell cycle regulation in breast cancer cells.
19917654 2010 IGF1 and its binding proteins 3 and 1 are differentially associated with metabolic syndrome in older men.
19913121 2009 Gene-centric association signals for lipids and apolipoproteins identified via the HumanCVD BeadChip.
19863750 2010 The influence of physical activity on ghrelin and IGF-1/IGFBP-3 levels in children and adolescents with type 1 diabetes mellitus.
19858071 2009 Common genetic variation in IGF1, IGFBP1 and IGFBP3 and ovarian cancer risk.
19846909 2009 The expression and function of IGFBP-3 in normal and malignant breast tissue.
19845745 2010 Free insulin-like growth factor (IGF)-1 and IGF-binding proteins-2 and -3 in serum and cerebrospinal fluid of amyotrophic lateral sclerosis patients.
19833751 2009 Perturbed insulin-like growth factor-1 (IGF-1) and IGF binding protein-3 are not associated with chronic widespread pain in men: results from the European Male Ageing Study.
19800385 2010 Characterisation of N-glycans bound to IGFBP-3 in sera from healthy adults.
19789190 2009 A gene-based risk score for lung cancer susceptibility in smokers and ex-smokers.
19786971 2009 Associations of insulin-like growth factor binding protein-3 gene polymorphisms with IGF-I activity and lipid parameters in adolescents.
19786462 2010 Racial differences in the association between body mass index and serum IGF1, IGF2, and IGFBP3.
19784788 2010 Association of IGF1 and IGFBP3 polymorphisms with colorectal polyps and colorectal cancer risk.
19764562 2009 [The expressions and clinical significance of IGFBP-2, -3 in both serum and tumor tissues in patients with epithelial ovarian cancer].
19734278 2009 Activity of human pregnancy insulin-like growth factor binding protein-3: determination by reconstituting recombinant complexes.
19692168 2010 Genetic susceptibility to distinct bladder cancer subphenotypes.
19672706 2010 Polymorphisms in the BRCA1 and ABCB1 genes modulate menopausal hormone therapy associated breast cancer risk in postmenopausal women.
19634593 2009 Predictors of variation in serum IGF1 and IGFBP3 levels in healthy African American and white men.
19633297 2009 Potentiation of growth factor signaling by insulin-like growth factor-binding protein-3 in breast epithelial cells requires sphingosine kinase activity.
19625176 2009 PTEN identified as important risk factor of chronic obstructive pulmonary disease.
19596932 2009 Insulin-like growth factor-binding protein-3 in osteosarcomas and normal bone tissues.
19591553 2009 Reduction of IGF-binding protein-3 as a potential marker of intra-uterine growth restriction.
19588500 2010 Biological effects induced by insulin-like growth factor binding protein 3 (IGFBP-3) in malignant melanoma.
19568604 2009 Influence of gender on serum growth hormone, insulin-like growth factor-I and its binding protein-3 during aging.
19556345 2009 Enhancing the apoptotic potential of insulin-like growth factor-binding protein-3 in prostate cancer by modulation of CK2 phosphorylation.
19551864 2010 Genetic variation and circulating levels of IGF-I and IGFBP-3 in relation to risk of proliferative benign breast disease.
19551141 2009 Analysis of germline variants in CDH1, IGFBP3, MMP1, MMP3, STK15 and VEGF in familial and sporadic renal cell carcinoma.
19540231 2009 Discovery and characterization of IGFBP-mediated endocytosis in the human retinal pigment epithelial cell line ARPE-19.
19527514 2009 Racial disparity in pathophysiologic pathways of preterm birth based on genetic variants.
19509068 2009 Novel mechanism of IGF-binding protein-3 action on prostate cancer cells: inhibition of proliferation, adhesion, and motility.
19492232 2009 Association between two functional polymorphisms of insulin-like growth factor binding protein 3 and colorectal cancer risk in a Chinese population.
19491931 2009 Phenotypes and genotypes of insulin-like growth factor 1, IGF-binding protein-3 and cancer risk: evidence from 96 studies.
19477944 2009 Unraveling insulin-like growth factor binding protein-3 actions in human disease.
19455605 2009 Genetic and plasma variation of insulin-like growth factor binding proteins in relation to prostate cancer incidence and survival.
19453261 2009 High-density association study of 383 candidate genes for volumetric BMD at the femoral neck and lumbar spine among older men.
19449212 2010 IGFBP3 polymorphisms and risk of cancer: a meta-analysis.
19414355 2009 Insulin-like growth factor-binding protein-3 in breast cancer: analysis with tissue microarray.
19332270 2009 Myocardial insulin-like growth factor-1 and insulin-like growth factor binding protein-3 gene expression in failing hearts harvested from patients undergoing cardiac transplantation.
19258508 2009 NKX3.1 activates expression of insulin-like growth factor binding protein-3 to mediate insulin-like growth factor-I signaling and cell proliferation.
19257984 2009 [An expression element of a new controlling insulin growth factors binding protein-3(IGFBP-3)in senescent cells].
19240240 2009 IGF-I and IGFBP-3 polymorphisms in relation to circulating levels among African American and Caucasian women.
19223521 2009 Mortality and serum insulin-like growth factor (IGF)-I and IGF binding protein 3 concentrations.
19217707 2009 Amniotic fluid insulin-like growth factor binding protein 3 concentration as early indicator of fetal growth restriction.
19207313 2009 IGF system in children with congenital disorders of glycosylation.
19194113 2009 Estradiol and testosterone levels are lower after oophorectomy than after natural menopause.
19190540 2009 A pharmacokinetic and dosing study of intravenous insulin-like growth factor-I and IGF-binding protein-3 complex to preterm infants.
19170196 2009 Polymorphisms in innate immunity genes and lung cancer risk in Xuanwei, China.
19159218 2009 Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry.
19158946 2009 IGFBP3 colocalizes with and regulates hypocretin (orexin).
19139490 2009 A strategy for precise and large scale identification of core fucosylated glycoproteins.
19138871 2009 Serum IGF-I and C-reactive protein in healthy black and white young men: the CARDIA male hormone study.
19129715 2009 Three novel IGFALS gene mutations resulting in total ALS and severe circulating IGF-I/IGFBP-3 deficiency in children of different ethnic origins.
19127217 2009 Effects of different CMV-heat-inactivation-methods on growth factors in human breast milk.
19124510 2009 Insulin-like growth factor-1- and interleukin-6-related gene variation and risk of multiple myeloma.
19124506 2009 Common genetic variation in candidate genes and susceptibility to subtypes of breast cancer.
19121847 2009 Diagnostic and prognostic role of the insulin growth factor pathway members insulin-like growth factor-II and insulin-like growth factor binding protein-3 in serous effusions.
19077426 2009 On combining triads and unrelated subjects data in candidate gene studies: an application to data on testicular cancer.
19064572 2008 Polymorphism in the IL18 gene and epithelial ovarian cancer in non-Hispanic white women.
19064126 2009 Insulin-like growth factor-I gene and insulin-like growth factor binding protein-3 polymorphism in patients with thyroid dysfunction.
19036873 2009 NOX4 mediates hypoxia-induced proliferation of human pulmonary artery smooth muscle cells: the role of autocrine production of transforming growth factor-{beta}1 and insulin-like growth factor binding protein-3.
19020726 2008 Overexpression of insulin-like growth factor binding protein 3 in oral squamous cell carcinoma.
19019335 2009 Spontaneous preterm birth in African Americans is associated with infection and inflammatory response gene variants.
19004037 2008 Elevated serum insulin-like growth factor (IGF-1) and IGF binding protein-3 levels in patients with systemic sclerosis: possible role in development of fibrosis.
18992263 2009 Colon tumor mutations and epigenetic changes associated with genetic polymorphism: insight into disease pathways.
18992148 2008 Low-penetrance alleles predisposing to sporadic colorectal cancers: a French case-controlled genetic association study.
18984657 2009 The -202 A allele of insulin-like growth factor binding protein-3 (IGFBP3) promoter polymorphism is associated with higher IGFBP-3 serum levels and better growth response to growth hormone treatment in patients with severe growth hormone deficiency.
18929499 2009 Genetic and epigenetic variability in the gene for IGFBP-3 (IGFBP3): correlation with serum IGFBP-3 levels and growth in short children born small for gestational age.
18818748 2008 Preterm birth in Caucasians is associated with coagulation and inflammation pathway gene variants.
18812263 2009 Race/ethnic variation in serum levels of IGF-I and IGFBP-3 in US adults.
18676680 2008 Pathway-based evaluation of 380 candidate genes and lung cancer susceptibility suggests the importance of the cell cycle pathway.
18636124 2008 Polymorphisms in the estrogen receptor 1 and vitamin C and matrix metalloproteinase gene families are associated with susceptibility to lymphoma.
18624627 2008 Lack of association of GH T1663A variation and IGFBP3-202A/C polymorphism with risk of ischemic stroke in Chinese.
18618736 2008 Insulin-like growth factor-I, insulin-like growth factor binding protein-3 and risk of benign prostate hyperplasia in the prostate cancer prevention trial.
18615538 2008 No association between a polymorphic variant of the IRS-1 gene and prostate cancer risk.
18602100 2008 Intracellular protein delivery activity of peptides derived from insulin-like growth factor binding proteins 3 and 5.
18596909 2008 IGF-1, IGFBP-1, and IGFBP-3 polymorphisms predict circulating IGF levels but not breast cancer risk: findings from the Breast and Prostate Cancer Cohort Consortium (BPC3).
18562769 2008 Genetic variation in insulin-like growth factors and brain tumor risk.
18534134 Relationship between leptin, insulin resistance, insulin-like growth factor-1 and insulin-like growth factor binding protein-3 in patients with chronic kidney disease.
18498652 2008 Local IGFBP-3 mRNA expression, apoptosis and risk of colorectal adenomas.
18481170 2009 Peptide concentrations and mRNA expression of IGF-I, IGF-II and IGFBP-3 in breast cancer and their associations with disease characteristics.
18471292 2008 Intact and total insulin-like growth factor-binding protein-3 (IGFBP-3) levels in relation to breast cancer risk factors: a cross-sectional study.
18459102 2008 Insulin-like growth factor binding protein-3 (IGFBP-3) in the prostate and in prostate cancer: local production, distribution and secretion pattern indicate a role in stromal-epithelial interaction.
18450319 2008 Single nucleotide polymorphisms of IGFBP-3 gene and lung cancer risk in a Korean population.
18410545 2008 IGF system and peripheral arterial disease: relationship with disease severity and inflammatory status of the affected limb.
18398029 2008 Genetic polymorphisms involved in insulin-like growth factor (IGF) pathway in relation to mammographic breast density and IGF levels.
18375957 2008 Polymorphisms of genes coding for ghrelin and its receptor in relation to anthropometry, circulating levels of IGF-I and IGFBP-3, and breast cancer risk: a case-control study nested within the European Prospective Investigation into Cancer and Nutrition (EPIC).
18335323 2008 Serum insulin-like growth factor (IGF)-I, IGF binding protein (IGFBP)-3, leptin concentrations and insulin resistance in benign and malignant epithelial ovarian tumors in postmenopausal women.
18329388 2008 Screening of senescence-associated genes with specific DNA array reveals the role of IGFBP-3 in premature senescence of human diploid fibroblasts.
18287864 2008 The role of IGFBP3 functional polymorphisms in the risk of gastric cancer in a high-risk Chinese population.
18259111 2008 Temporal changes in insulin-like growth factors I and II and in insulin-like growth factor binding proteins 1, 2, and 3 in human milk.
18178497 2008 Changes in total ghrelin within the somatotropic axis in severe burn patients: comparison of those with inhalation injury and those without inhalation injury.
18177247 2008 Associations of insulin-like growth factor (IGF)-I and IGF-binding protein-3 with HIV disease progression in women.
18171112 2008 Role of insulin-like growth factor binding protein-3 in human umbilical vein endothelial cell senescence.
18163429 2008 Genetic polymorphisms in CYP17, CYP3A4, CYP19A1, SRD5A2, IGF-1, and IGFBP-3 and prostate cancer risk in African-American men: the Flint Men's Health Study.
18162523 2008 Induction of apoptosis in human prostate cancer cells by insulin-like growth factor binding protein-3 does not require binding to retinoid X receptor-alpha.
18084616 2007 IGFBP3 promoter methylation in colorectal cancer: relationship with microsatellite instability, CpG island methylator phenotype, and p53.
18059035 2008 Leptin and leptin receptor genotypes and colon cancer: gene-gene and gene-lifestyle interactions.
18031946 2007 Polymorphisms in the insulin like growth factor 1 and IGF binding protein 3 genes and risk of colorectal cancer.
18006928 2007 Longitudinal study of insulin-like growth factor, insulin-like growth factor binding protein-3, and their polymorphisms: risk of neoplastic progression in Barrett's esophagus.
17997337 2008 Reference ranges of serum IGF-1 and IGFBP-3 levels in a general adult population: results of the Study of Health in Pomerania (SHIP).
17972510 Evidence for a tumour suppressive function of IGF1-binding proteins in human breast cancer.
17959403 2008 An N-terminal fragment of insulin-like growth factor binding protein-3 (IGFBP-3) induces apoptosis in human prostate cancer cells in an IGF-independent manner.
17957164 2007 Aortic intima-media thickness, serum IGF-I, IGFBP-3, and leptin levels in intrauterine growth-restricted newborns of healthy mothers.
17952116 2008 Insulin-like growth factor binding protein-3 (IGFBP-3) acts as an invasion-metastasis suppressor in ovarian endometrioid carcinoma.
17912004 2007 Spinal bone mineral density, IGF-1 and IGFBP-3 in children with cerebral palsy.
17879951 2007 Association of IGF-1 and IGFBP-3 with lower urinary tract symptoms in the third national health and nutrition examination survey.
17827406 2007 Human papillomavirus type 16 E7 oncoprotein inhibits apoptosis mediated by nuclear insulin-like growth factor-binding protein-3 by enhancing its ubiquitin/proteasome-dependent degradation.
17823260 2007 Identification of upstream stimulatory factor binding sites in the human IGFBP3 promoter and potential implication of adjacent single-nucleotide polymorphisms and responsiveness to insulin.
17803702 2008 Correlation of serum IGF-I and IGFBP-1 and -3 to cardiovascular risk indicators and early carotid atherosclerosis in healthy middle-aged men.
17763192 2007 Insulin-like growth factor (IGF)-I, IGF-II and IGF-binding protein (IGFBP)-3 levels in Arab subjects with coronary heart disease.
17761791 2007 Influence of promoter region variants of insulin-like growth factor pathway genes on the strength-training response of muscle phenotypes in older adults.
17724372 2007 IGF-1 and IGFBP-3 gene variants influence on serum levels and prostate cancer risk in African-Americans.
17719815 2008 IGFBP-3 sensitizes prostate cancer cells to interferon-gamma-induced apoptosis.
17689128 2007 Serum ghrelin levels but not GH, IGF-1 and IGFBP-3 levels are altered in patients with fibromyalgia syndrome.
17668637 2007 Grade-specific prostate cancer associations of IGF1 (CA)19 repeats and IGFBP3-202A/C in blacks and whites.
17655506 2007 Calpain proteolysis of insulin-like growth factor binding protein (IGFBP) -2 and -3, but not of IGFBP-1.
17635417 2007 Regulation of replicative senescence by insulin-like growth factor-binding protein 3 in human umbilical vein endothelial cells.
17627014 2007 Mammographic density and candidate gene variants: a twins and sisters study.
17624927 2007 Hypoxia-inducible factor-1alpha (HIF-1alpha) gene polymorphisms, circulating insulin-like growth factor binding protein (IGFBP)-3 levels and prostate cancer.
17597108 2007 IGF-1 and IGFBP-3: Risk of prostate cancer among men in the Prostate, Lung, Colorectal and Ovarian Cancer Screening Trial.
17593323 2007 A 30-kDa fragment of insulin-like growth factor (IGF) binding protein-3 in human pregnancy serum with strongly reduced IGF-I binding.
17591901 2007 The requirement of pax6 for postnatal eye development: evidence from experimental mouse chimeras.
17577982 2007 [Soluble high-expression, purification and bioassay of IGFBP-3].
17567756 2007 IGFBP3 suppresses retinopathy through suppression of oxygen-induced vessel loss and promotion of vascular regrowth.
17566087 2007 Genetic determinants of circulating insulin-like growth factor (IGF)-I, IGF binding protein (BP)-1, and IGFBP-3 levels in a multiethnic population.
17560154 2007 Severe deficiencies of IGF-I, IGF-II, IGFBP-3, ALS and paradoxically high-normal bone mass in a child with insulin-resistance syndrome (Rabson-Mendenhall type).
17555512 2007 Exon 3-deleted genotype of growth hormone receptor (GHRd3) positively influences IGF-1 increase at generation test in children with idiopathic short stature.
17546465 2007 Common genetic variation in eight genes of the GH/IGF1 axis does not contribute to adult height variation.
17457048 2007 IGFBP-3 regulates esophageal tumor growth through IGF-dependent and independent mechanisms.
17453001 2007 In silico mining identifies IGFBP3 as a novel target of methylation in prostate cancer.
17447118 2007 The influence of serum ghrelin, IGF axis and testosterone on bone mineral density in boys at different stages of sexual maturity.
17446556 2007 Proteomics demonstration that normal breast epithelial cells can induce apoptosis of breast cancer cells through insulin-like growth factor-binding protein-3 and maspin.
17434920 2007 Contribution of the orphan nuclear receptor Nur77 to the apoptotic action of IGFBP-3.
17434446 2007 N-Acetylgalactosaminyltransferase 14, a novel insulin-like growth factor binding protein-3 binding partner.
17396438 2007 Short stature in children with sickle cell anemia correlates with alterations in the IGF-I axis.
17388800 2007 Insulin-like growth factor binding protein-3 induces angiogenesis through IGF-I- and SphK1-dependent mechanisms.
17350302 2007 Effects of heterozygosity for the E180 splice mutation causing growth hormone receptor deficiency in Ecuador on IGF-I, IGFBP-3, and stature.
17300730 2007 Common genetic variation in IGF1, IGFBP-1, and IGFBP-3 in relation to mammographic density: a cross-sectional study.
17297462 2007 CDX2 promotes anchorage-independent growth by transcriptional repression of IGFBP-3.
17293864 2007 A common coding variant in CASP8 is associated with breast cancer risk.
17289909 2007 IGF-II gene region polymorphisms related to exertional muscle damage.
17287408 2007 Growth hormone-binding protein is directly and IGFBP-3 is inversely associated with risk of female breast cancer.
17264182 2007 Association of total insulin-like growth factor-I, insulin-like growth factor binding protein-1 (IGFBP-1), and IGFBP-3 levels with incident coronary events and ischemic stroke.
17237715 2007 Insulin-like growth factor binding protein-3 induces insulin resistance in adipocytes in vitro and in rats in vivo.
17210081 2007 IGFBP3 mRNA expression in benign and malignant breast tumors.
17187018 2006 Cord blood IGF-1 and IGFBP-3 levels in asphyxiated term newborns.
17172410 2006 Association of insulin-like growth factor binding protein-3 expression with melanoma progression.
17119061 2006 Ethnic disparity in the relationship between obesity and plasma insulin-like growth factors: the multiethnic cohort.
17113753 2007 Serum levels of insulin-like growth factors (IGFs) and their binding proteins (IGFBPs), -1, -2, -3, in oral cancer.
17096329 2007 Aberrant promoter methylation of insulin-like growth factor binding protein-3 gene in human cancers.
17085968 2006 Altered gene expression of caspase-10, death receptor-3 and IGFBP-3 in preeclamptic placentas.
17070193 2006 Insulin-like growth factor-II (IGF-II), IGF-binding protein-3 (IGFBP-3), and IGFBP-4 in follicular fluid are associated with oocyte maturation and embryo development.
17063263 2007 Genetic variation in IGF1, IGF-1R, IGFALS, and IGFBP3 in breast cancer survival among Chinese women: a report from the Shanghai Breast Cancer Study.
17056474 IGFBP-3 and IGFBP-10 (CYR61) up-regulation during the development of Barrett's oesophagus and associated oesophageal adenocarcinoma: potential biomarkers of disease risk.
17051426 2007 Genetic variation in IGF1, IGFBP3, IRS1, IRS2 and risk of breast cancer in women living in Southwestern United States.
17047053 2006 ADAM28 is overexpressed in human breast carcinomas: implications for carcinoma cell proliferation through cleavage of insulin-like growth factor binding protein-3.
17044098 2007 IGF1, growth pathway polymorphisms and schizophrenia: a pooling study.
17035411 2006 Haplotype-based association studies of IGFBP1 and IGFBP3 with prostate and breast cancer risk: the multiethnic cohort.
17018785 2006 Commonly studied single-nucleotide polymorphisms and breast cancer: results from the Breast Cancer Association Consortium.
16969385 2006 IGF-I and IGFBP-3 augment transforming growth factor-beta actions in human renal carcinoma cells.
16965600 2006 High expression of insulin-like growth factor binding protein-3 is correlated with lower portal invasion and better prognosis in human hepatocellular carcinoma.
16959974 2006 The consensus coding sequences of human breast and colorectal cancers.
16935391 2006 The prognostic significance of pretreatment plasma levels of insulin-like growth factor (IGF)-1, IGF-2, and IGF binding protein-3 in patients with advanced non-small cell lung cancer.
16915540 2006 Insulin-like growth factor binding protein-2 (IGFBP-2) is a marker for the metabolic syndrome.
16887362 2006 Inverse correlation between serum free IGF-I and IGFBP-3 levels and blood pressure in patients affected with type 1 diabetes.
16825320 2006 Growth inhibitory concentrations of androgens up-regulate insulin-like growth factor binding protein-3 expression via an androgen response element in LNCaP human prostate cancer cells.
16793770 2006 Nonsecreted insulin-like growth factor binding protein-3 (IGFBP-3) can induce apoptosis in human prostate cancer cells by IGF-independent mechanisms without being concentrated in the nucleus.
16776662 2006 Gender differences in the insulin-like growth factor axis response to a glucose load.
16775172 2006 Circulating insulin-like growth factor-I and binding protein-3 and risk of prostate cancer.
16763062 2006 Insulin-like growth factor binding protein-3 in extracellular matrix stimulates adhesion of breast epithelial cells and activation of p44/42 mitogen-activated protein kinase.
16723126 2006 Characterization of the expression of the hypoxia-induced genes neuritin, TXNIP and IGFBP3 in cancer.
16645643 2007 Insulin-like growth factor binding protein 3 (IGFBP-3) potentiates TRAIL-induced apoptosis of human colorectal carcinoma cells through inhibition of NF-kappaB.
16617154 2006 Insulin-like growth factor binding protein-3: insulin-like growth factor independence comes of age.
16614079 2006 Insulin-like growth factor binding protein 3 has opposing actions on malignant and nonmalignant breast epithelial cells that are each reversible and dependent upon cholesterol-stabilized integrin receptor complexes.
16552541 2006 Expression of genes involved in the regulation of p16 in psoriatic involved skin.
16543235 2006 Several acidic amino acids in the N-domain of insulin-like growth factor-binding protein-5 are important for its transactivation activity.
16541420 2006 Differential regulation of IGFBP-3 by the androgen receptor in the lineage-related androgen-dependent LNCaP and androgen-independent C4-2 prostate cancer models.
16540651 2006 Nuclear insulin-like growth factor binding protein-3 induces apoptosis and is targeted to ubiquitin/proteasome-dependent proteolysis.
16489531 2006 PPARgamma and colon and rectal cancer: associations with specific tumor mutations, aspirin, ibuprofen and insulin-related genes (United States).
16489075 2006 The relationship of insulin-like growth factor-II, insulin-like growth factor binding protein-3, and estrogen receptor-alpha expression to disease progression in epithelial ovarian cancer.
16455777 2006 Ribonucleic acid polymerase II binding subunit 3 (Rpb3), a potential nuclear target of insulin-like growth factor binding protein-3.
16448675 2006 Polymorphisms in insulin-related genes predispose to specific KRAS2 and TP53 mutations in colon cancer.
16404426 2006 Polymorphisms of genes coding for insulin-like growth factor 1 and its major binding proteins, circulating levels of IGF-I and IGFBP-3 and breast cancer risk: results from the EPIC study.
16394092 2006 A prospective study of serum insulin-like growth factor I (IGF-I) and IGF-binding protein-3 in 942 healthy infants: associations with birth weight, gender, growth velocity, and breastfeeding.
16335952 Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry.
16322329 2005 Differential expression of IGF-binding protein-3 in normal and malignant colon and its influence on apoptosis.
16306136 2006 IGF1 and IGFBP3 tagging polymorphisms are associated with circulating levels of IGF1, IGFBP3 and risk of breast cancer.
16303743 2005 Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries.
16275148 2006 Novel actions of IGFBP-3 on intracellular signaling pathways of insulin-secreting cells.
16215864 2005 Genetic, anthropometric, and lifestyle factors associated with IGF-1 and IGFBP-3 levels in Hispanic and non-Hispanic white women.
16211216 2005 IGFBP-3 expression in hepatocellular carcinoma involves abnormalities in TGF-beta and/or Rb signaling pathways.
16210470 2006 EGF-mediated regulation of IGFBP-3 determines esophageal epithelial cellular response to IGF-I.
16189260 2005 Insulin-like growth factor binding protein-3 leads to insulin resistance in adipocytes.
16189247 2005 Recombinant, nonglycosylated human insulin-like growth factor-binding protein-3 (IGFBP-3) is degraded preferentially after administration to type II diabetics, resulting in increased endogenous glycosylated IGFBP-3.
16181731 2006 The prognostic role of loss of insulin-like growth factor-binding protein-3 expression in head and neck carcinogenesis.
16049980 2006 Promoter -202 A/C polymorphism of insulin-like growth factor binding protein-3 gene and non-small cell lung cancer risk.
16030120 2005 Insulin-like growth factor pathway polymorphisms associated with body size in Hispanic and non-Hispanic white women.
16015705 2005 Expression of albumin, IGF-1, IGFBP-3 in tumor tissues and adjacent non-tumor tissues of hepatocellular carcinoma patients with cirrhosis.
15987847 2005 Insulin-like growth factor II and binding proteins 1 and 3 from second trimester human amniotic fluid are associated with infant birth weight.
15986122 2005 Polymorphisms in the IGF-1 and IGFBP 3 promoter and the risk of breast cancer.
15959422 2005 Cord serum insulin-like growth factor binding protein-1 and -3: effect of maternal diabetes and relationships to fetal growth.
15941947 2005 Variation in plasma insulin-like growth factor-1 and insulin-like growth factor binding protein-3: genetic factors.
15927849 2005 Thrombospondin 1, produced by endothelial cells under the action of erythropoietin, stimulates thymidine incorporation into erythroid cells and counteracts the inhibitory action of insulin-like growth factor binding protein 3.
15894694 2005 Association of an exon 1 polymorphism in the IGFBP3 gene with circulating IGFBP-3 levels and colorectal cancer risk: the multiethnic cohort study.
15894673 2005 Insulin-like growth factor polymorphisms and colorectal cancer risk.
15844718 2005 Insulin-like growth factor binding protein 3 in inflammatory bowel disease.
15817480 2005 Characterization of a novel positive transcription regulatory element that differentially regulates the insulin-like growth factor binding protein-3 (IGFBP-3) gene in senescent cells.
15809062 2005 Impact of PTEN on the expression of insulin-like growth factors (IGFs) and IGF-binding proteins in human gastric adenocarcinoma cells.
15802501 2005 Enhancement of tumor necrosis factor-alpha-induced growth inhibition by insulin-like growth factor-binding protein-5 (IGFBP-5), but not IGFBP-3 in human breast cancer cells.
15800934 2005 IGF-I and IGFBP-3 polymorphisms and risk of prostate cancer.
15781645 2005 IGFBP-3 is a direct target of transcriptional regulation by DeltaNp63alpha in squamous epithelium.
15769996 2005 p53-Dependent and p53-independent induction of insulin-like growth factor binding protein-3 by deoxyribonucleic acid damage and hypoxia.
15734965 2005 IGF1 (CA)19 repeat and IGFBP3 -202 A/C genotypes and the risk of prostate cancer in Black and White men.
15703779 2005 High IGFBP-3 levels in marrow plasma in early-stage MDS: effects on apoptosis and hemopoiesis.
15681824 2005 Insulin-like growth factor binding proteins 3 and 5 are overexpressed in idiopathic pulmonary fibrosis and contribute to extracellular matrix deposition.
15668470 2005 Polymorphisms and circulating levels in the insulin-like growth factor system and risk of breast cancer: a systematic review.
15661050 2005 Altered messenger RNA and protein expressions for insulin-like growth factor family members in clear cell and papillary renal cell carcinomas.
15651061 2005 Role of insulin-like growth factor binding proteins in 1alpha,25-dihydroxyvitamin D(3)-induced growth inhibition of human prostate cancer cells.
15642732 2005 Interaction of insulin-like growth factor II (IGF-II) with multiple plasma proteins: high affinity binding of plasminogen to IGF-II and IGF-binding protein-3.
15642160 2005 Immunohistochemical expression of insulin-like growth factor binding protein-3 in invasive breast cancers and ductal carcinoma in situ: implications for clinicopathology and patient outcome.
15641264 Correlation of sex steroids with IGF-1 and IGFBP-3 during different pubertal stages.
15641262 Influence of iodine supplementation on serum insulin-like growth factor-I (IGF-I) and IGF-binding protein-3 (IGFBP-3) levels in severe iodine deficiency.
15625284 2005 Circulating insulin-like growth factor-1 and insulin-like growth factor binding protein-3 are associated with early carotid atherosclerosis.
15517912 The role of insulin-like growth factor 1 and insulin-like growth factor binding protein 3 in human esophageal cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15485880 2004 Role of N- and C-terminal residues of insulin-like growth factor (IGF)-binding protein-3 in regulating IGF complex formation and receptor activation.
15448002 2004 Met proto-oncogene and insulin-like growth factor binding protein 3 overexpression correlates with metastatic ability in well-differentiated pancreatic endocrine neoplasms.
15379965 2004 Insulin-like 3 signalling in testicular descent.
15340161 2004 Signal peptide prediction based on analysis of experimentally verified cleavage sites.
15302288 2004 Effects of conjugated equine estrogen vs. raloxifene on serum insulin-like growth factor-i and insulin-like growth factor binding protein-3: a 2-year, double-blind, placebo-controlled study.
15298948 2004 Genetic polymorphisms in the IGFBP3 gene: association with breast cancer risk and blood IGFBP-3 protein levels among Chinese women.
15282325 2004 EWS/FLI-1 silencing and gene profiling of Ewing cells reveal downstream oncogenic pathways and a crucial role for repression of insulin-like growth factor binding protein 3.
15247904 2004 Mechanisms underlying lack of insulin-like growth factor-binding protein-3 expression in non-small-cell lung cancer.
15247132 2004 Associations among IRS1, IRS2, IGF1, and IGFBP3 genetic polymorphisms and colorectal cancer.
15221971 2004 IGF-I and breast cancer: a meta-analysis.
15198293 2004 Plasma insulin-like growth factors (IGFs), IGF-Binding proteins (IGFBPs), acid-labile subunit (ALS) and IGFBP-3 proteolysis in individuals with clinical characteristics of Sotos syndrome.
15178549 2004 IGFBP-3 activates TGF-beta receptors and directly inhibits growth in human intestinal smooth muscle cells.
15140235 2004 Reduced expression of insulin-like growth factor-binding protein-3 (IGFBP-3) in Squamous cell carcinoma complicating recessive dystrophic epidermolysis bullosa.
15126567 2004 The role of the acid-labile subunit in regulating insulin-like growth factor transport across human umbilical vein endothelial cell monolayers.
15086466 2004 The roles of IGF-I and IGFBP-3 in the regulation of proximal tubule, and renal cell carcinoma cell proliferation.
15070968 2004 Insulin-like growth factor binding protein-3 expression is associated with growth stimulation of T47D human breast cancer cells: the role of altered epidermal growth factor signaling.
15069073 2004 Tissue transglutaminase has intrinsic kinase activity: identification of transglutaminase 2 as an insulin-like growth factor-binding protein-3 kinase.
15067329 2004 cDNA microarray analysis with amplified RNA after isolation of intact cellular RNA from neoplastic and non-neoplastic prostate tissue separated by laser microdissections.
15066922 2004 A polymorphic locus in the promoter region of the IGFBP3 gene is related to mammographic breast density.
15059907 2004 Insulin-like growth factor binding protein-3 interacts with autocrine motility factor/phosphoglucose isomerase (AMF/PGI) and inhibits the AMF/PGI function.
15047131 2004 Insulin-like growth factor-I/insulin-like growth factor binding protein-3 alters lymphocyte responsiveness following severe burn.
15014034 2004 Elevated serum insulin-like growth factor binding protein-2 as a prognostic marker in patients with ovarian cancer.
14760718 2004 Screening for N-glycosylated proteins by liquid chromatography mass spectrometry.
14751238 2004 Insulin-like growth factor binding protein-3 stimulates phosphatidylinositol 3-kinase in MCF-7 breast carcinoma cells.
14744783 2004 Matrix metalloproteinase-7 facilitates insulin-like growth factor bioavailability through its proteinase activity on insulin-like growth factor binding protein 3.
14718574 2004 The human plasma proteome: a nonredundant list developed by combination of four separate sources.
14710345 Adaptations of the IGF system during malignancy: human skeletal muscle versus the systemic environment.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14693733 2003 Comprehensive assessment of candidate genes and serological markers for the detection of prostate cancer.
14674122 2003 The impact of progesterone on simultaneous, local secretion of IGFBP-3 and IGF-I [IGFBP-3/IGF-I index] by human malignant and non-malignant breast explants depends on tissue steroid receptor phenotype.
14644829 2003 Urokinase-type plasminogen activator and insulin-like growth factor-binding protein 3 mRNA expression in endometriotic lesions and eutopic endometrium: implications for the pathophysiology of endometriosis.
14598881 2003 Role of insulin-like growth factor binding proteins (IGFBPs) in breast cancer proliferation and metastasis.
14597676 2003 Cellular growth inhibition by IGFBP-3 and TGF-beta1 requires LRP-1.
14576164 2004 Cellular internalization of insulin-like growth factor binding protein-3: distinct endocytic pathways facilitate re-uptake and nuclear localization.
14576163 2004 Insulin-like growth factor-independent effects mediated by a C-terminal metal-binding domain of insulin-like growth factor binding protein-3.
14561895 2003 Interaction between the Alzheimer's survival peptide humanin and insulin-like growth factor-binding protein 3 regulates cell survival and apoptosis.
12962157 2003 Interaction of insulin-like growth factor binding protein-3 with latent transforming growth factor-beta binding protein-1.
12937269 2003 Matrix metalloproteinase 19 regulates insulin-like growth factor-mediated proliferation, migration, and adhesion in human keratinocytes through proteolysis of insulin-like growth factor binding protein-3.
12926118 Effects of tamoxifen on insulin-like growth factors, IGF binding proteins and IGFBP-3 proteolysis in breast cancer patients.
12925957 2003 Polymorphic variation at the -202 locus in IGFBP3: Influence on serum levels of insulin-like growth factors, interaction with plasma retinol and vitamin D and breast cancer risk.
12907612 2003 Insulin-like growth factor-binding protein-3 gene -202 A/C polymorphism is correlated with advanced disease status in prostate cancer.
12870155 2003 Serum levels of insulin-like growth factor-I (IGF-I), and IGF-binding proteins-1 and -3 in middle-aged and young athletes versus sedentary men: relationship with glucose disposal.
12865482 2003 Serum Sex Hormones, IGF-1, and IGFBP3 Exert a Sexually Dimorphic Effect on Lean Body Mass in Aging.
12853948 2003 The DNA sequence of human chromosome 7.
12810534 2003 Structural and functional evidence for the interaction of insulin-like growth factors (IGFs) and IGF binding proteins with vitronectin.
12810533 2003 Amino- and carboxyl-terminal fragments of insulin-like growth factor (IGF) binding protein-3 cooperate to bind IGFs with high affinity and inhibit IGF receptor interactions.
12735930 Type Ialpha collagen is an IGFBP-3 binding protein.
12730416 2003 Soy isoflavones do not modulate circulating insulin-like growth factor concentrations in an older population in an intervention trial.
12725526 2003 Functional cloning of IGFBP-3 from human microvascular endothelial cells reveals its novel role in promoting proliferation of primitive CD34+CD38- hematopoietic cells in vitro.
12690205 2003 Human chromosome 7: DNA sequence and biology.
12599210 2003 Role of insulin-like growth factor binding protein-3 (IGFBP-3) in the differentiation of primary human adult skeletal myoblasts.
12590636 2003 Augmented serum levels of the IGF-I/IGF-binding protein-3 ratio in pre-menopausal patients with type I breast cysts.
12575534 [Morphological, cytogenetic and molecular biological characteristics of lung cancer in persons exposed for a long time to radionuclide radiation pollution in the Semipalatinsk region of Kazakhstan].
12571851 2003 Synthesis of insulin-like growth factor binding protein 3 in vitro in human articular cartilage cultures.
12571183 2003 Insulin-like growth factor (IGF)-1 and IGF binding protein-1 and -3 in the follicular fluid of infertile patients with endometriosis.
12519841 2003 Free and total insulin-like growth factor (IGF)-I, -II, and IGF binding protein-1, -2, and -3 serum levels in patients with active thyroid eye disease.
12508918 2002 IGF system in acute ischemic stroke.
12506097 2003 Expression of IGFBP-3 by human retinal endothelial cell cultures: IGFBP-3 involvement in growth inhibition and apoptosis.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
12473575 2002 Correlation between insulin-like growth factor-binding protein-3 promoter methylation and prognosis of patients with stage I non-small cell lung cancer.
12242693 2002 Role of insulin-like growth factor binding protein-3 in breast cancer cell growth.
12220677 2002 Insulin-like growth factor binding protein-3 increases intracellular calcium concentrations in MCF-7 breast carcinoma cells.
12219010 2002 Plasma from patients undergoing major open surgery stimulates in vitro tumor growth: Lower insulin-like growth factor binding protein 3 levels may, in part, account for this change.
12213898 2002 IGF-I/IGF-binding protein-3 combination improves insulin resistance by GH-dependent and independent mechanisms.
12210764 2002 Evidence implicating a mid-region sequence of IGFBP-3 in its specific IGF-independent actions.
12200149 2002 Trichostatin A, a histone deacetylase inhibitor, activates the IGFBP-3 promoter by upregulating Sp1 activity in hepatoma cells: alteration of the Sp1/Sp3/HDAC1 multiprotein complex.
12163384 2002 Insulin-like growth factor-binding protein 3 expression increases during immortalization of cervical keratinocytes by human papillomavirus type 16 E6 and E7 proteins.
12150454 2002 Insulin-like growth factor binding proteins 1 and 3 and breast cancer outcomes.
12135130 2002 Circulating levels of insulin-like growth factor-1 and its binding proteins in patients with hypertrophic cardiomyopathy.
12127836 2002 Co-localization of insulin-like growth factor binding protein 3 and fibronectin in human articular cartilage.
12122101 2002 Insulin-like growth factor-I (IGF-I) and IGF binding protein-3 as predictors of advanced-stage prostate cancer.
12111701 2002 Insulin-like growth factors and risk of benign prostatic hyperplasia.
12011225 2002 Insulin-like growth factor I, IGF-binding protein 3, and lung cancer risk in a prospective study of men in China.
12006706 2002 Insulin-like growth factors and insulin-like growth factor binding proteins in adult patients with severe liver disease before and after orthotopic liver transplantation.
11971816 2002 Insulin-like growth factor binding protein-3 mediates tumor necrosis factor-alpha-induced apoptosis: role of Bcl-2 phosphorylation.
11959812 2002 A possible role for insulin-like growth factor-binding protein-3 autocrine/paracrine loops in controlling hepatocellular carcinoma cell proliferation.
11953210 2002 [Relation between insulin-like growth factor-1 and insulin resistance in patients with acute stroke].
11914026 2001 Total and free insulin-like growth factor I, insulin-like growth factor binding protein 3 and acid-labile subunit reflect clinical activity in acromegaly.
11914023 2001 Reduced serum insulin-like growth factor-1 (IGF-1) and IGF-binding protein-3 levels in adults with inflammatory bowel disease.
11886859 2002 Identification of STAT-1 as a molecular target of IGFBP-3 in the process of chondrogenesis.
11804742 2002 Reduced expression of insulin-like growth factor binding protein-3 and its promoter hypermethylation in human hepatocellular carcinoma.
11801256 2002 Decreased intracellular degradation of insulin-like growth factor binding protein-3 in cathepsin L-deficient fibroblasts.
11762714 2001 Serum insulin-like growth factor type 1, insulin-like growth factor-binding protein-1, and insulin-like growth factor-binding protein-3 concentrations in patients with thyroid dysfunction.
11749962 2001 Transferrin binds insulin-like growth factors and affects binding properties of insulin-like growth factor binding protein-3.
11600567 2001 Mutation of three critical amino acids of the N-terminal domain of IGF-binding protein-3 essential for high affinity IGF binding.
11375929 2001 Diverse transcriptional initiation revealed by fine, large-scale mapping of mRNA start sites.
11344214 2001 Insulin-like growth factor (IGF)-binding protein-3 (IGFBP-3) binds to fibronectin (FN): demonstration of IGF-I/IGFBP-3/fn ternary complexes in human plasma.
11319179 2001 Genetic and nongenetic factors associated with variation of plasma levels of insulin-like growth factor-I and insulin-like growth factor-binding protein-3 in healthy premenopausal women.
11297622 2001 Transferrin is an insulin-like growth factor-binding protein-3 binding protein.
11264294 2001 Pregnancy-associated plasma protein-A2 (PAPP-A2), a novel insulin-like growth factor-binding protein-5 proteinase.
11238520 2001 Novel promoter polymorphism in insulin-like growth factor-binding protein-3: correlation with serum levels and interaction with known regulators.
10874028 2000 Direct functional interactions between insulin-like growth factor-binding protein-3 and retinoid X receptor-alpha regulate transcriptional signaling and apoptosis.
10849447 2000 ADAM 12, a disintegrin metalloprotease, interacts with insulin-like growth factor-binding protein-3.
10811646 2000 Nuclear import of insulin-like growth factor-binding protein-3 and -5 is mediated by the importin beta subunit.
10770214 2000 Changes in insulin-like growth factor-binding protein-3 messenger ribonucleic acid in endothelial cells of the human corpus luteum: a possible role in luteal development and rescue.
10766744 2000 Substitutions for hydrophobic amino acids in the N-terminal domains of IGFBP-3 and -5 markedly reduce IGF-I binding and alter their biologic actions.
10650937 2000 The effect of phosphorylation by casein kinase 2 on the activity of insulin-like growth factor-binding protein-3.
10512690 1999 Inflammation-related neutrophil proteases, cathepsin G and elastase, function as insulin-like growth factor binding protein proteases.
10511594 1999 Growth regulation of prostatic stromal cells by prostate-specific antigen.
10407151 1999 Biosensor measurement of the interaction kinetics between insulin-like growth factors and their binding proteins.
10352394 1999 Insulin-like growth factor binding proteins: new proteins, new functions.
10226805 The heparin binding domain of insulin-like growth factor binding protein (IGFBP)-3 increases susceptibility of IGFBP-3 to proteolysis.
10218588 1999 The cleavage site specificity of human prostate specific antigen for insulin-like growth factor binding protein-3.
10076184 1999 Characterisation of recombinant glycosylation variants of insulin-like growth factor binding protein-3.
9688635 1998 Plasminogen binds the heparin-binding domain of insulin-like growth factor-binding protein-3.
9497324 1998 Insulin-like growth factor (IGF)-binding protein 5 forms an alternative ternary complex with IGFs and the acid-labile subunit.
9446566 1998 Structural determinants of ligand and cell surface binding of insulin-like growth factor-binding protein-3.
9408744 1997 Insulin-like growth factor-binding proteins in serum and other biological fluids: regulation and functions.
9389554 1997 Insulin-like growth factor (IGF) binding protein-3 interacts with the type 1 IGF receptor, reducing the affinity of the receptor for its ligand: an alternative mechanism in the regulation of IGF action.
9388210 1997 Inhibition of insulin receptor activation by insulin-like growth factor binding proteins.
9337997 1997 Proteolytic fragments of insulin-like growth factor binding protein-3: N-terminal sequences and relationships between structure and biological activity.
9275067 1997 Proteolysis of insulin-like growth factors (IGF) and IGF binding proteins by cathepsin D.
9252371 1997 The type V transforming growth factor beta receptor is the putative insulin-like growth factor-binding protein 3 receptor.
8964576 1996 IGF-binding protein mRNAs in the human fetus: tissue and cellular distribution of developmental expression.
8843739 1996 IGFBP-3 proteolysis by plasmin, thrombin, serum: heparin binding, IGF binding, and structure of fragments.
8708531 1996 Expression of IGF-I and IGF-binding protein genes in cirrhotic liver.
8675597 1996 The expression of insulin-like growth factor (IGF) and IGF-binding protein (IGFBP) genes in the human placenta and membranes: evidence for IGF-IGFBP interactions at the feto-maternal interface.
8550744 1996 Identification and characterization of insulin-like growth factors (IGFs), IGF-binding proteins (IGFBPs), and IGFBP proteases in human synovial fluid.
7566179 1995 Induction of the growth inhibitor IGF-binding protein 3 by p53.
7538844 1994 Biochemical analysis of prostate specific antigen-proteolyzed insulin-like growth factor binding protein-3.
7523391 1994 Matrix metalloproteinases degrade insulin-like growth factor-binding protein-3 in dermal fibroblast cultures.
7508771 1993 Analysis of the primary structure of insulin-like growth factor binding protein-3 cDNA from Werner syndrome fibroblasts.
2464130 1988 Cloning and expression of the growth hormone-dependent insulin-like growth factor-binding protein.
1726837 1991 Purification from human cerebrospinal fluid of insulin-like growth factor binding proteins (IGFBPs). Isolation of IGFBP-2, an altered form of IGFBP-3 and a new IGFBP species.
1697583 1990 Isolation from adult human serum of four insulin-like growth factor (IGF) binding proteins and molecular cloning of one of them that is increased by IGF I administration and in extrapancreatic tumor hypoglycemia.
1695633 1990 Insulin-like growth factor binding protein-3. Organization of the human chromosomal gene and demonstration of promoter activity.
1383255 1992 Prostate-specific antigen (PSA) is an insulin-like growth factor binding protein-3 protease found in seminal plasma.
1373120 1992 Contiguous localization of the genes encoding human insulin-like growth factor binding proteins 1 (IGBP1) and 3 (IGBP3) on chromosome 7.
1293182 1992 Biochemical study of cells cultured from a patient with tuberous sclerosis.
1280211 1992 Measurement and characterization of insulin-like growth factor binding protein-3 in human biological fluids: discrepancies between radioimmunoassay and ligand blotting.