Property Summary

NCBI Gene PubMed Count 599
Grant Count 585
R01 Count 353
Funding $56,474,143.32
PubMed Score 2121.26
PubTator Score 2165.75

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Relevance (54)

Disease Z-score Confidence
Cancer 2,346 5.577 2.8
Acromegaly 40 4.993 2.5
Laron syndrome 9 4.859 2.4
diabetes mellitus 1,663 4.392 2.2
Turner syndrome 31 4.32 2.2
Obesity 616 4.255 2.1
Hypoglycemia 81 4.145 2.1
Hypopituitarism 36 3.899 1.9
Osteoporosis 257 3.599 1.8
Silver-Russell syndrome 37 3.551 1.8
Kidney failure 39 3.509 1.8
Hyperinsulinism 63 3.496 1.7
Hypothyroidism 89 3.417 1.7
Polycystic Ovary Syndrome 332 3.356 1.7
Liver disease 219 3.264 1.6
Vascular disease 281 3.218 1.6
Anorexia nervosa 59 3.081 1.5
Autistic Disorder 320
Bladder Neoplasm 109
Carcinoma, Transitional Cell 31
Colorectal Neoplasms 217
Duchenne muscular dystrophy 602
Myocardial Ischemia 169
Prostatic Neoplasms 471
Rheumatoid Arthritis 1,160
Spontaneous abortion 108
Stomach Neoplasms 282
adrenocortical carcinoma 1,427
astrocytoma 1,493
autosomal dominant Emery-Dreifuss muscul... 499 
breast carcinoma 1,614
cystic fibrosis and chronic rhinosinusit... 213 
dermatomyositis 933
ependymoma 2,514
esophageal adenocarcinoma 737
glioblastoma 5,572
group 4 medulloblastoma 1,875
intraductal papillary-mucinous adenoma (... 2,956 
juvenile dermatomyositis 1,189
lung adenocarcinoma 2,713
lung cancer 4,466
medulloblastoma, large-cell 6,234
non-small cell lung cancer 2,798
oligodendroglioma 2,849
ovarian cancer 8,484
pancreatic cancer 2,300
pediatric high grade glioma 2,712
pituitary cancer 1,972
primary Sjogren syndrome 789
primary pancreatic ductal adenocarcinoma 1,271
psoriasis 6,685
pterygium 74
tuberculosis 1,557
ulcerative colitis 2,087

Expression

Synonym

Accession P17936 A4D2F5 D3DVM0 Q2V509 Q6P1M6 Q9UCL4 IBP-3
Symbols IBP3
BP-53

Gene

Gene RIF (577)

PMID Text
27071409 Independent of obesity, high insulin levels but reduced levels of IGFBP-3 were associated with increased lung cancer risk in current smokers.
26975989 Study showed that IGFBP3 is dramatically induced in pancreatic tumors, and is abundantly produced in pancreatic cancer cells, causing muscle wasting through both impaired myogenesis via, at least, inhibition of IGF/PI3K/AKT signaling.
26902691 Metformin resulted in a significant reduction of IGF-1, IGF-1: IGFBP-3 molar ratio, insulin, FBG and HOMA-IR. On the other hand, metformin caused a significant increase of IGFBP-3.
26893016 Higher IGF-I levels among postmenopausal women and an elevated IGF-I:IGFBP-3 ratio among all women were associated with higher TDLU counts ; these associations were strongest among women with elevated mammographic density
26731648 Data indicate that IGF-binding protein 3 (IGFBP3) and F3 gene expression levels in formalin fixed paraffin embedded (FFPE) prostate cancer tissue would provide an improved survival prediction for prostate cancer patients.
26670461 Insulin-like growth factor binding protein-3 is a new predictor of radiosensitivity on esophageal squamous cell carcinoma
26637371 calcineurin in astrocytes was activated by Amyloid beta, leading to IGFBP-3 release.
26540630 Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells via integrin beta1 signaling.
26388613 Circulating levels of IGF-1, IGFBP-3 and their molar ratio were not associated with the risk of occurrence of colorectal adenoma
26378048 endogenous IGFBP-3 is a p53 target that plays a role in breast cancer cell responsiveness to DNA damaging therapy
More...

AA Sequence

MQRARPTLWAAALTLLVLLRGPPVARAGASSAGLGPVVRCEPCDARALAQCAPPPAVCAELVREPGCGCC      1 - 70
LTCALSEGQPCGIYTERCGSGLRCQPSPDEARPLQALLDGRGLCVNASAVSRLRAYLLPAPPAPGNASES     71 - 140
EEDRSAGSVESPSVSSTHRVSDPKFHPLHSKIIIIKKGHAKDSQRYKVDYESQSTDTQNFSSESKRETEY    141 - 210
GPCRREMEDTLNHLKFLNVLSPRGVHIPNCDKKGFYKKKQCRPSKGRKRGFCWCVDKYGQPLPGYTTKGK    211 - 280
EDVHCYSMQSK                                                               281 - 291
//

Text Mined References (605)

PMID Year Title
27071409 2016 Associations of Insulin and IGFBP-3 with Lung Cancer Susceptibility in Current Smokers.
26975989 2016 Pancreatic cancer cell-derived IGFBP-3 contributes to muscle wasting.
26902691 2016 Metformin may protect nondiabetic breast cancer women from metastasis.
26893016 2016 Circulating insulin-like growth factor-I, insulin-like growth factor binding protein-3 and terminal duct lobular unit involution of the breast: a cross-sectional study of women with benign breast disease.
26731648 2016 Improving the Prediction of Prostate Cancer Overall Survival by Supplementing Readily Available Clinical Data with Gene Expression Levels of IGFBP3 and F3 in Formalin-Fixed Paraffin Embedded Core Needle Biopsy Material.
26670461 2015 Insulin-like growth factor binding protein-3 is a new predictor of radiosensitivity on esophageal squamous cell carcinoma.
26637371 2015 The participation of insulin-like growth factor-binding protein 3 released by astrocytes in the pathology of Alzheimer's disease.
26540630 2015 Insulin-like growth factor-independent insulin-like growth factor binding protein 3 promotes cell migration and lymph node metastasis of oral squamous cell carcinoma cells by requirement of integrin ?1.
26388613 2015 Circulating levels of IGF-1, IGFBP-3, and IGF-1/IGFBP-3 molar ratio and colorectal adenomas: A meta-analysis.
26378048 2015 Involvement of p53 in insulin-like growth factor binding protein-3 regulation in the breast cancer cell response to DNA damage.
More...