Property Summary

Ligand Count 23
NCBI Gene PubMed Count 592
PubMed Score 2447.44
PubTator Score 642.08

Knowledge Summary


No data available


  Disease (4)


 GWAS Trait (1)

PDB (46)

Gene RIF (538)

AA Sequence

VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI                                  211 - 250

Text Mined References (600)

PMID Year Title