Property Summary

NCBI Gene PubMed Count 495
Grant Count 290
R01 Count 169
Funding $43,877,031.91
PubMed Score 2249.49
PubTator Score 642.08

Knowledge Summary

Patent

No data available

Expression

Synonym

Accession P17931 B2RC38 Q16005 Q6IBA7 Q96J47 Gal-3
Symbols L31
GAL3
MAC2
CBP35
GALBP
GALIG
LGALS2

Gene

PANTHER Protein Class (1)

PDB

1A3K   1KJL   1KJR   2NMN   2NMO   2NN8   2XG3   3AYA   3AYC   3AYD   3AYE   3T1L   3T1M   3ZSJ   3ZSK   3ZSL   3ZSM   4BLI   4BLJ   4BM8   4JC1   4JCK   4LBJ   4LBK   4LBL   4LBM   4LBN   4LBO   4R9A   4R9B   4R9C   4R9D   4RL7   4XBN   5E88   5E89   5E8A   5H9P   5H9R  

Gene RIF (447)

PMID Text
26891020 The integrative analysis of galectins(Gal-1, -3, -4, -9) discriminated IBD from other intestinal inflammatory conditions and could be used as potential mucosal biomarker
26885508 Galectin-1 was undetectable in normal and ulcerative colitis colonic epithelium, while galectin-2, galectin-3, and galectin-4 were strongly expressed.
26869635 Report elevated galectin-3 levels in pulmonary arterial hypertension.
26781273 Gal-3 likely participates in mechanisms of aldosterone-mediated myocardial damage in a heart failure murine model with cardiac hyperaldosteronism.
26760037 binding of recombinant Gal-3 to the RPE cell surface and inhibitory effects on RPE attachment and spreading largely dependent on interaction with Mgat5 modified N-glycans
26722123 Circulating Gal-3 was associated with abdominal adiposity, dyslipidemia, and hypertension in cross-sectional analyses, but Gal-3 did not predict incident cardiometabolic disease after adjusting for cardiometabolic risk factors.
26718452 following successful knockdown of galecin-3 expression in Eca109 cells, the cell proliferation, migration and invasion were reduced, while the apoptosis was enhanced.
26708131 This study provides evidence for a prognostic clinical potential of the combined study of GAL-3 and CRIP-1 in endometrial cancer
26663797 Serum galectin-3 is a biomarker of fibrosis in cirrhosis and toxic hepatitis, which reflects the stage of liver damage.
26589797 galectin-1 and -3 are expressed by the human cervical and vaginal epithelial cells and act as pathogen-recognition receptors for the ceramide phosphoinositol glycan core (CPI-GC) of the dominant surface protozoan lipophosphoglycan.
More...

AA Sequence

MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAY      1 - 70
PGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP     71 - 140
NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK    141 - 210
VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI                                  211 - 250
//

Text Mined References (503)

PMID Year Title
26891020 A galectin-specific signature in the gut delineates Crohn's disease and ulcerative colitis from other human inflammatory intestinal disorders.
26885508 2016 Immunohistochemical Studies on Galectin Expression in Colectomised Patients with Ulcerative Colitis.
26869635 2016 Galectin-3 and aldosterone as potential tandem biomarkers in pulmonary arterial hypertension.
26781273 2016 Inhibition of Galectin-3 Pathway Prevents Isoproterenol-Induced Left Ventricular Dysfunction and Fibrosis in Mice.
26760037 2016 Epithelial-to-Mesenchymal Transition of RPE Cells In Vitro Confers Increased ?1,6-N-Glycosylation and Increased Susceptibility to Galectin-3 Binding.
26722123 2015 Circulating Galectin-3 Is Associated With Cardiometabolic Disease in the Community.
26718452 2016 Gene silencing of galectin-3 changes the biological behavior of Eca109 human esophageal cancer cells.
26708131 2016 Co-expression of galectin-3 and CRIP-1 in endometrial cancer: prognostic value and patient survival.
26663797 2015 Galectin-3 Concentration in Liver Diseases.
26589797 2016 Trichomonas vaginalis Lipophosphoglycan Exploits Binding to Galectin-1 and -3 to Modulate Epithelial Immunity.
More...