Property Summary

Ligand Count 23
NCBI Gene PubMed Count 592
PubMed Score 2447.44
PubTator Score 642.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

 GWAS Trait (1)

Gene RIF (538)

AA Sequence

MADNFSLHDALSGSGNPNPQGWPGAWGNQPAGAGGYPGASYPGAYPGQAPPGAYPGQAPPGAYPGAPGAY      1 - 70
PGAPAPGVYPGPPSGPGAYPSSGQPSATGAYPATGPYGAPAGPLIVPYNLPLPGGVVPRMLITILGTVKP     71 - 140
NANRIALDFQRGNDVAFHFNPRFNENNRRVIVCNTKLDNNWGREERQSVFPFESGKPFKIQVLVEPDHFK    141 - 210
VAVNDAHLLQYNHRVKKLNEISKLGISGDIDLTSASYTMI                                  211 - 250
//

Text Mined References (600)

PMID Year Title