Property Summary

NCBI Gene PubMed Count 193
Grant Count 290
R01 Count 187
Funding $38,233,193.95
PubMed Score 2279.88
PubTator Score 1220.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.028
Waldenstrons macroglobulinemia -1.101 0.018
chronic lymphosyte leukemia -2.600 0.000
osteosarcoma -3.685 0.000
tuberculosis 3.100 0.000
interstitial cystitis 2.700 0.000
primary Sjogren syndrome 1.500 0.013
nasopharyngeal carcinoma -2.000 0.000
lung carcinoma -1.800 0.000
mucosa-associated lymphoid tissue lympho... 2.829 0.013
ulcerative colitis 2.300 0.000
ovarian cancer -1.600 0.000
axial spondyloarthropathy 1.100 0.041

Synonym

Accession P17927 Q16744 Q16745 Q5SR43 Q5SR45 Q9UQV2
Symbols KN
C3BR
C4BR
CD35

Gene

CR1

PDB

1GKG   1GKN   1GOP   1PPQ   2MCY   2MCZ   2Q7Z   5FO9  

Protein-protein Interaction (3)

Gene RIF (151)

PMID Text
26914463 the Putative Role of CR1 in Alzheimer's Disease
26650353 CyaA binding did not trigger downstream signaling of CR3 in human monocytes and CyaA-catalyzed elevation of cAMP effectively blocked CR3 signaling initiated by a natural ligand.
26273660 The C4d/CR1 ratio is a simple and quickly determinable biomarker that enables the differentiation between infection and flare-up in febrile SLE patients at initial evaluation.
26260209 These results provide a framework for understanding how loss of CR1 expression on podocytes may contribute to complement-mediated damage in the kidney.
26189291 THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES
25916414 Knops blood group antigen a/b genotype was associated with increased susceptibility to severe malaria and the b/b genotype was associated with reduced risk of severe malaria.
25742728 Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells
25683978 CR1 gene rs2274567 G/A, rs4844600 G/A, and rs2296160 C/T polymorphisms may not be involved in susceptibility to malaria in Chinese population.
25494101 findings provide evidence that the A carrier (AG/GG) and the A allele of the ECR1 A3650G polymorphism may be correlated to the pathogenesis of NRDS and, hence, might be involved in the susceptibility to NRDS.
25349208 Data indicate that complement activation promote complement component 3 C3b deposition on native and acetylated LDL and binding to the complement receptor 1 (CR1).
More...

AA Sequence

MGASSPRSPEPVGPPAPGLPFCCGGSLLAVVVLLALPVAWGQCNAPEWLPFARPTNLTDEFEFPIGTYLN      1 - 70
YECRPGYSGRPFSIICLKNSVWTGAKDRCRRKSCRNPPDPVNGMVHVIKGIQFGSQIKYSCTKGYRLIGS     71 - 140
SSATCIISGDTVIWDNETPICDRIPCGLPPTITNGDFISTNRENFHYGSVVTYRCNPGSGGRKVFELVGE    141 - 210
PSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKC    211 - 280
QALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQEVFYSCEPGYDLRGAASMRCTPQGDWSPAA    281 - 350
PTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGFQLKGSSASYCVLAGMESLWNSSVPVCEQIF    351 - 420
CPSPPVIPNGRHTGKPLEVFPFGKTVNYTCDPHPDRGTSFDLIGESTIRCTSDPQGNGVWSSPAPRCGIL    421 - 490
GHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGRPFSITCLDNLVWSSPKDVCKRKSCKTPPDP    491 - 560
VNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGNAAHWSTKPPICQRIPCGLPPTIANGDFIST    561 - 630
NRENFHYGSVVTYRCNPGSGGRKVFELVGEPSIYCTSNDDQVGIWSGPAPQCIIPNKCTPPNVENGILVS    631 - 700
DNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPELPSCSRVCQPPPDVLHAERTQRDKDNFSPGQ    701 - 770
EVFYSCEPGYDLRGAASMRCTPQGDWSPAAPTCEVKSCDDFMGQLLNGRVLFPVNLQLGAKVDFVCDEGF    771 - 840
QLKGSSASYCVLAGMESLWNSSVPVCEQIFCPSPPVIPNGRHTGKPLEVFPFGKAVNYTCDPHPDRGTSF    841 - 910
DLIGESTIRCTSDPQGNGVWSSPAPRCGILGHCQAPDHFLFAKLKTQTNASDFPIGTSLKYECRPEYYGR    911 - 980
PFSITCLDNLVWSSPKDVCKRKSCKTPPDPVNGMVHVITDIQVGSRINYSCTTGHRLIGHSSAECILSGN    981 - 1050
TAHWSTKPPICQRIPCGLPPTIANGDFISTNRENFHYGSVVTYRCNLGSRGRKVFELVGEPSIYCTSNDD   1051 - 1120
QVGIWSGPAPQCIIPNKCTPPNVENGILVSDNRSLFSLNEVVEFRCQPGFVMKGPRRVKCQALNKWEPEL   1121 - 1190
PSCSRVCQPPPEILHGEHTPSHQDNFSPGQEVFYSCEPGYDLRGAASLHCTPQGDWSPEAPRCAVKSCDD   1191 - 1260
FLGQLPHGRVLFPLNLQLGAKVSFVCDEGFRLKGSSVSHCVLVGMRSLWNNSVPVCEHIFCPNPPAILNG   1261 - 1330
RHTGTPSGDIPYGKEISYTCDPHPDRGMTFNLIGESTIRCTSDPHGNGVWSSPAPRCELSVRAGHCKTPE   1331 - 1400
QFPFASPTIPINDFEFPVGTSLNYECRPGYFGKMFSISCLENLVWSSVEDNCRRKSCGPPPEPFNGMVHI   1401 - 1470
NTDTQFGSTVNYSCNEGFRLIGSPSTTCLVSGNNVTWDKKAPICEIISCEPPPTISNGDFYSNNRTSFHN   1471 - 1540
GTVVTYQCHTGPDGEQLFELVGERSIYCTSKDDQVGVWSSPPPRCISTNKCTAPEVENAIRVPGNRSFFS   1541 - 1610
LTEIIRFRCQPGFVMVGSHTVQCQTNGRWGPKLPHCSRVCQPPPEILHGEHTLSHQDNFSPGQEVFYSCE   1611 - 1680
PSYDLRGAASLHCTPQGDWSPEAPRCTVKSCDDFLGQLPHGRVLLPLNLQLGAKVSFVCDEGFRLKGRSA   1681 - 1750
SHCVLAGMKALWNSSVPVCEQIFCPNPPAILNGRHTGTPFGDIPYGKEISYACDTHPDRGMTFNLIGESS   1751 - 1820
IRCTSDPQGNGVWSSPAPRCELSVPAACPHPPKIQNGHYIGGHVSLYLPGMTISYICDPGYLLVGKGFIF   1821 - 1890
CTDQGIWSQLDHYCKEVNCSFPLFMNGISKELEMKKVYHYGDYVTLKCEDGYTLEGSPWSQCQADDRWDP   1891 - 1960
PLAKCTSRTHDALIVGTLSGTIFFILLIIFLSWIILKHRKGNNAHENPKEVAIHLHSQGGSSVHPRTLQT   1961 - 2030
NEENSRVLP                                                                2031 - 2039
//

Publication (196)

PMID Year Title
26914463 2016 Analysis of the Putative Role of CR1 in Alzheimer's Disease: Genetic Association, Expression and Function.
26650353 2015 Bordetella adenylate cyclase toxin is a unique ligand of the integrin complement receptor 3.
26273660 2015 Analysis of Erythrocyte C4d to Complement Receptor 1 Ratio: Use in Distinguishing between Infection and Flare-Up in Febrile Patients with Systemic Lupus Erythematosus.
26260209 2015 Role of complement receptor 1 (CR1; CD35) on epithelial cells: A model for understanding complement-mediated damage in the kidney.
26189291 2015 [THE COMBINATION OF EXPRESSION OF MARKERS CR1 AND CR2 (CD35/CD21) IN DIAGNOSTIC OF B-CELL LYMPHOPROLIFERATIVE DISEASES].
25916414 2015 Severity of malaria in relation to a complement receptor 1 polymorphism: a case-control study.
25742728 2015 Complement receptor type 1 (CR1/CD35) expressed on activated human CD4+ T cells contributes to generation of regulatory T cells.
25683978 2015 Association of the single-nucleotide polymorphism and haplotype of the complement receptor 1 gene with malaria.
25494101 2015 Correlation of ECR1 A3650G polymorphism with neonatal respiratory distress syndrome.
25349208 2014 Differential complement activation pathways promote C3b deposition on native and acetylated LDL thereby inducing lipoprotein binding to the complement receptor 1.
More...