Property Summary

NCBI Gene PubMed Count 192
Grant Count 258
R01 Count 170
Funding $37,673,576.37
PubMed Score 715.47
PubTator Score 457.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.400 0.005
fibroadenoma 2.300 0.001
Breast cancer -1.700 0.000

Synonym

Accession P17861 Q8WYK6 Q969P1 Q96BD7 XBP-1
Symbols XBP2
TREB5
XBP-1
TREB-5

Gene

Gene RIF (175)

PMID Text
26742428 Our results reveal that IRE1alpha-XBP1 pathway plays an important role in tumor progression and epithelial-to-mesenchymal transition (EMT), and IRE1alpha could be employed as a novel prognostic marker and a promising therapeutic target for CRC.
26680227 High XBP1 expression is associated with glioma.
26633383 Overexpression of X-Box Binding Protein 1 (XBP1) Correlates to Poor Prognosis and Up-Regulation of PI3K/mTOR in Human Osteosarcoma
26517687 Overexpression of XBP1 is associated with breast cancer.
26491160 These results provide evidence that XBP-1s is a direct activator of Kaposi's sarcoma-associated herpesvirus vIL-6 and that this is an important step in the pathogenesis of KSHV-Castleman disease and primary effusion lymphoma.
26483401 An RNA-intrinsic conformational change causes the intron of XBP1 mRNA to be ejected and the exons to zipper up into an extended stem, juxtaposing the RNA ends for ligation; These conformational rearrangements are important for XBP1 mRNA splicing in vivo
26469762 Data (including data from studies in transgenic/knockout mice) suggest insulin secretion in beta-cells is up-regulated in hyperglycemia via IRE1a- (inositol requiring enzyme 1 alpha)-mediated changes in XBP1 (X-box binding protein 1) mRNA splicing.
26331676 XBP-1 is required for cytokine production by inflamed human airway epithelia. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201504-0657OC#.VwqgNdLrvyA
26299655 The study supports a role for -116C/G polymorphism of the XBP1 promoter in the pathogenesis of T2D in a Chinese Han population
26134873 the present study provides initial evidence that RITA upregulates the expression level of IRE1a by increasing the stability of IRE1alpha mRNA in irradiated mtp53-expressing cervical cancer cells
More...

AA Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPE      1 - 70
EKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMD     71 - 140
ALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTT    141 - 210
WTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN                       211 - 261
//

Publication (201)

PMID Year Title
26742428 2016 Activation of IRE1?-XBP1 pathway induces cell proliferation and invasion in colorectal carcinoma.
26680227 2016 XBP1 silencing decreases glioma cell viability and glycolysis possibly by inhibiting HK2 expression.
26633383 2015 Overexpression of X-Box Binding Protein 1 (XBP1) Correlates to Poor Prognosis and Up-Regulation of PI3K/mTOR in Human Osteosarcoma.
26517687 2015 A novel chemical, STF-083010, reverses tamoxifen-related drug resistance in breast cancer by inhibiting IRE1/XBP1.
26491160 2015 Induction of Kaposi's Sarcoma-Associated Herpesvirus-Encoded Viral Interleukin-6 by X-Box Binding Protein 1.
26483401 2015 A conformational RNA zipper promotes intron ejection during non-conventional XBP1 mRNA splicing.
26469762 2015 The IRE1?/XBP1s Pathway Is Essential for the Glucose Response and Protection of ? Cells.
26331676 2015 X-Box-Binding Protein 1 and Innate Immune Responses of Human Cystic Fibrosis Alveolar Macrophages.
26299655 2016 Polymorphism - 116C/G of the human X box binding protein 1 gene is associated with risk of type 2 diabetes in a Chinese Han population.
26134873 2015 RITA enhances irradiation-induced apoptosis in p53-defective cervical cancer cells via upregulation of IRE1?/XBP1 signaling.
More...