Property Summary

Ligand Count 3
NCBI Gene PubMed Count 209
PubMed Score 780.25
PubTator Score 457.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
Breast cancer -1.700 4.3e-06
breast carcinoma 1.400 4.6e-03
fibroadenoma 2.000 2.3e-03

Gene RIF (193)

AA Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPE      1 - 70
EKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMD     71 - 140
ALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTT    141 - 210
WTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN                       211 - 261
//

Text Mined References (218)

PMID Year Title