Property Summary

NCBI Gene PubMed Count 192
PubMed Score 715.47
PubTator Score 457.14

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (3)

Disease log2 FC p
breast carcinoma 1.400 0.005
fibroadenoma 2.300 0.001
Breast cancer -1.700 0.000

Synonym

Accession P17861 Q8WYK6 Q969P1 Q96BD7 XBP-1
Symbols XBP2
TREB5
XBP-1
TREB-5

Gene

  Ortholog (8)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Cow EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG

Gene RIF (175)

PMID Text
26742428 Our results reveal that IRE1alpha-XBP1 pathway plays an important role in tumor progression and epithelial-to-mesenchymal transition (EMT), and IRE1alpha could be employed as a novel prognostic marker and a promising therapeutic target for CRC.
26680227 High XBP1 expression is associated with glioma.
26633383 Overexpression of X-Box Binding Protein 1 (XBP1) Correlates to Poor Prognosis and Up-Regulation of PI3K/mTOR in Human Osteosarcoma
26517687 Overexpression of XBP1 is associated with breast cancer.
26491160 These results provide evidence that XBP-1s is a direct activator of Kaposi's sarcoma-associated herpesvirus vIL-6 and that this is an important step in the pathogenesis of KSHV-Castleman disease and primary effusion lymphoma.
26483401 An RNA-intrinsic conformational change causes the intron of XBP1 mRNA to be ejected and the exons to zipper up into an extended stem, juxtaposing the RNA ends for ligation; These conformational rearrangements are important for XBP1 mRNA splicing in vivo
26469762 Data (including data from studies in transgenic/knockout mice) suggest insulin secretion in beta-cells is up-regulated in hyperglycemia via IRE1a- (inositol requiring enzyme 1 alpha)-mediated changes in XBP1 (X-box binding protein 1) mRNA splicing.
26331676 XBP-1 is required for cytokine production by inflamed human airway epithelia. Read More: http://www.atsjournals.org/doi/full/10.1164/rccm.201504-0657OC#.VwqgNdLrvyA
26299655 The study supports a role for -116C/G polymorphism of the XBP1 promoter in the pathogenesis of T2D in a Chinese Han population
26134873 the present study provides initial evidence that RITA upregulates the expression level of IRE1a by increasing the stability of IRE1alpha mRNA in irradiated mtp53-expressing cervical cancer cells
More...

AA Sequence

MVVVAAAPNPADGTPKVLLLSGQPASAAGAPAGQALPLMVPAQRGASPEAASGGLPQARKRQRLTHLSPE      1 - 70
EKALRRKLKNRVAAQTARDRKKARMSELEQQVVDLEEENQKLLLENQLLREKTHGLVVENQELRQRLGMD     71 - 140
ALVAEEEAEAKGNEVRPVAGSAESAALRLRAPLQQVQAQLSPLQNISPWILAVLTLQIQSLISCWAFWTT    141 - 210
WTQSCSSNALPQSLPAWRSSQRSTQKDPVPYQPPFLCQWGRHQPSWKPLMN                       211 - 261
//

Text Mined References (201)

PMID Year Title
26742428 2016 Activation of IRE1?-XBP1 pathway induces cell proliferation and invasion in colorectal carcinoma.
26680227 2016 XBP1 silencing decreases glioma cell viability and glycolysis possibly by inhibiting HK2 expression.
26633383 2015 Overexpression of X-Box Binding Protein 1 (XBP1) Correlates to Poor Prognosis and Up-Regulation of PI3K/mTOR in Human Osteosarcoma.
26517687 2015 A novel chemical, STF-083010, reverses tamoxifen-related drug resistance in breast cancer by inhibiting IRE1/XBP1.
26491160 2015 Induction of Kaposi's Sarcoma-Associated Herpesvirus-Encoded Viral Interleukin-6 by X-Box Binding Protein 1.
26483401 2015 A conformational RNA zipper promotes intron ejection during non-conventional XBP1 mRNA splicing.
26469762 2015 The IRE1?/XBP1s Pathway Is Essential for the Glucose Response and Protection of ? Cells.
26331676 2015 X-Box-Binding Protein 1 and Innate Immune Responses of Human Cystic Fibrosis Alveolar Macrophages.
26299655 2016 Polymorphism - 116C/G of the human X box binding protein 1 gene is associated with risk of type 2 diabetes in a Chinese Han population.
26134873 2015 RITA enhances irradiation-induced apoptosis in p53-defective cervical cancer cells via upregulation of IRE1?/XBP1 signaling.
More...