Property Summary

NCBI Gene PubMed Count 46
PubMed Score 104.39
PubTator Score 46.89

Knowledge Summary

Patent (6,378)

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -4.000 0.000
osteosarcoma -3.628 0.000
ependymoma 1.100 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.004
lung cancer -2.800 0.000
pancreatic cancer -1.200 0.001

Synonym

Accession P17858 Q96A64 Q96IH4 Q9BR91 ATP-PFK
Symbols PFK-B
PFK-L
ATP-PFK

Gene

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (6)

PMID Text
22923583 findings showed glycosylation inhibited PFK1 activity and redirected glucose flux through the pentose phosphate pathway, thereby conferring a selective growth advantage on cancer cells
22174317 HIV-1 Rev interacting protein, phosphofructokinase, liver (PFKL), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20602615 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of phosphofructokinase, liver (PFKL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18254975 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANW      1 - 70
LSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELV     71 - 140
AEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGR    141 - 210
HCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVK    211 - 280
DLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLME    281 - 350
CVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS    351 - 420
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIH    421 - 490
ALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSAS    491 - 560
GTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNEKC    561 - 630
HDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVF    631 - 700
ANAPDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVT    701 - 770
RRTLSMDKGF                                                                771 - 780
//

Text Mined References (51)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22923583 2012 Phosphofructokinase 1 glycosylation regulates cell growth and metabolism.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21505073 2011 The human AIRE gene at chromosome 21q22 is a genetic determinant for the predisposition to rheumatoid arthritis in Japanese population.
21269460 2011 Initial characterization of the human central proteome.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
More...