Property Summary

NCBI Gene PubMed Count 46
PubMed Score 104.39
PubTator Score 46.89

Knowledge Summary

Patent (6,378)

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
osteosarcoma 7933 1.7451021003101E-11
ependymoma 2514 4.95581029471458E-6
psoriasis 6685 5.23972172910516E-6
malignant mesothelioma 3163 2.1126436538354E-5
lung cancer 4473 3.21754206160942E-4
pancreatic cancer 2300 0.00100570542867248
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0041837970165567
Disease Target Count Z-score Confidence
Down syndrome 548 4.163 2.1
Autoimmune polyendocrine syndrome type 1 7 3.308 1.7

Expression

  Differential Expression (7)

Disease log2 FC p
malignant mesothelioma 1.200 0.000
psoriasis -4.000 0.000
osteosarcoma -3.628 0.000
ependymoma 1.100 0.000
intraductal papillary-mucinous adenoma (... -1.200 0.004
lung cancer -2.800 0.000
pancreatic cancer -1.200 0.001

Synonym

Accession P17858 Q96A64 Q96IH4 Q9BR91 ATP-PFK
Symbols PFK-B
PFK-L
ATP-PFK

Gene

  Ortholog (12)

Species Source
Chimp OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Platypus OMA EggNOG
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA Inparanoid
Fruitfly OMA Inparanoid
S.cerevisiae OMA EggNOG Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

Gene RIF (6)

PMID Text
22923583 findings showed glycosylation inhibited PFK1 activity and redirected glucose flux through the pentose phosphate pathway, thereby conferring a selective growth advantage on cancer cells
22174317 HIV-1 Rev interacting protein, phosphofructokinase, liver (PFKL), is identified by the in-vitro binding experiments involving cytosolic or nuclear extracts from HeLa cells
20602615 Observational study of gene-disease association. (HuGE Navigator)
18996102 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
18854154 Knockdown of phosphofructokinase, liver (PFKL) by siRNA inhibits the early stages of HIV-1 replication in 293T cells infected with VSV-G pseudotyped HIV-1
18254975 Observational study of gene-disease association. (HuGE Navigator)

AA Sequence

MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANW      1 - 70
LSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELV     71 - 140
AEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGR    141 - 210
HCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVK    211 - 280
DLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLME    281 - 350
CVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS    351 - 420
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIH    421 - 490
ALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSAS    491 - 560
GTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNEKC    561 - 630
HDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVF    631 - 700
ANAPDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVT    701 - 770
RRTLSMDKGF                                                                771 - 780
//

Text Mined References (51)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
22923583 2012 Phosphofructokinase 1 glycosylation regulates cell growth and metabolism.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22223895 2012 Comparative large scale characterization of plant versus mammal proteins reveals similar and idiosyncratic N-?-acetylation features.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21505073 2011 The human AIRE gene at chromosome 21q22 is a genetic determinant for the predisposition to rheumatoid arthritis in Japanese population.
21269460 2011 Initial characterization of the human central proteome.
20602615 2010 Physiogenomic analysis of statin-treated patients: domain-specific counter effects within the ACACB gene on low-density lipoprotein cholesterol?
More...