Property Summary

NCBI Gene PubMed Count 47
PubMed Score 107.60
PubTator Score 46.89

Knowledge Summary

Patent (6,378)

Expression

  Differential Expression (7)

Disease log2 FC p
ependymoma 1.100 5.0e-06
intraductal papillary-mucinous adenoma (... -1.200 4.2e-03
lung cancer -2.800 3.2e-04
malignant mesothelioma 1.200 2.1e-05
osteosarcoma -3.628 1.7e-11
pancreatic cancer -1.200 1.0e-03
psoriasis 1.800 1.0e-04

Protein-protein Interaction (3)

Gene RIF (7)

AA Sequence

MAAVDLEKLRASGAGKAIGVLTSGGDAQGMNAAVRAVTRMGIYVGAKVFLIYEGYEGLVEGGENIKQANW      1 - 70
LSVSNIIQLGGTIIGSARCKAFTTREGRRAAAYNLVQHGITNLCVIGGDGSLTGANIFRSEWGSLLEELV     71 - 140
AEGKISETTARTYSHLNIAGLVGSIDNDFCGTDMTIGTDSALHRIMEVIDAITTTAQSHQRTFVLEVMGR    141 - 210
HCGYLALVSALASGADWLFIPEAPPEDGWENFMCERLGETRSRGSRLNIIIIAEGAIDRNGKPISSSYVK    211 - 280
DLVVQRLGFDTRVTVLGHVQRGGTPSAFDRILSSKMGMEAVMALLEATPDTPACVVTLSGNQSVRLPLME    281 - 350
CVQMTKEVQKAMDDKRFDEATQLRGGSFENNWNIYKLLAHQKPPKEKSNFSLAILNVGAPAAGMNAAVRS    351 - 420
AVRTGISHGHTVYVVHDGFEGLAKGQVQEVGWHDVAGWLGRGGSMLGTKRTLPKGQLESIVENIRIYGIH    421 - 490
ALLVVGGFEAYEGVLQLVEARGRYEELCIVMCVIPATISNNVPGTDFSLGSDTAVNAAMESCDRIKQSAS    491 - 560
GTKRRVFIVETMGGYCGYLATVTGIAVGADAAYVFEDPFNIHDLKVNVEHMTEKMKTDIQRGLVLRNEKC    561 - 630
HDYYTTEFLYNLYSSEGKGVFDCRTNVLGHLQQGGAPTPFDRNYGTKLGVKAMLWLSEKLREVYRKGRVF    631 - 700
ANAPDSACVIGLKKKAVAFSPVTELKKDTDFEHRMPREQWWLSLRLMLKMLAQYRISMAAYVSGELEHVT    701 - 770
RRTLSMDKGF                                                                771 - 780
//

Text Mined References (52)

PMID Year Title