Property Summary

NCBI Gene PubMed Count 106
Grant Count 22
R01 Count 13
Funding $1,904,021.58
PubMed Score 108.61
PubTator Score 103.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
non-small cell lung cancer -1.318 0.000
diabetes mellitus -1.600 0.005
subependymal giant cell astrocytoma -1.271 0.009
ovarian cancer -2.200 0.000

Protein-protein Interaction (164)

U2SURP   POLR2D   DHX15   PRPF4   SART1   HNRNPR   PRPF3   PPIH   PLRG1   NUDT21   DHX16   AQR   CDC40   PQBP1   PRPF40A   SF3B1   WBP4   SNRNP200   BCAS2   DNAJC8   SMNDC1   PRPF6   PCF11   CD2BP2   CPSF4   LSM8   SYF2   HNRNPC   SNRPB2   SNRNP70   SNRPA   SNRPC   HNRNPA1   SNRPA1   HSPA8   GTF2F2   SNRPB   HNRNPL   POLR2C   POLR2E   HNRNPA2B1   POLR2A   U2AF2   PTBP1   POLR2B   HNRNPH1   CSTF2   GTF2F1   FUS   POLR2I   RBMX   EIF4A3   BUD31   PAPOLA   HNRNPA3   HNRNPM   POLR2H   POLR2J   HNRNPF   RBM5   POLR2K   SNU13   HNRNPH2   POLR2F   MAGOH   HNRNPK   SNRPE   SNRPF   SNRPG   LSM3   LSM6   SNRPD1   SNRPD2   SNRPD3   POLR2G   POLR2L   TRA2B   SNURF   YBX1   TXNL4A   SRSF3   HNRNPU   U2AF1   SRSF2   CSTF1   SRSF11   SRSF1   SRSF4   DHX9   CPSF1   SF3A3   ELAVL2   CSTF3   HNRNPA0   SRSF9   SRSF5   SRSF6   SF3B2   SNW1   HNRNPD   EFTUD2   RNPS1   PCBP1   PCBP2   SF3B3   SF3B4   SF3A2   SF3A1   SF1   ELAVL1   SRSF7   USP39   PRPF8   FIP1L1   CWC27   DDX46   PHF5A   PABPN1   ALYREF   DDX42   CHERP   SUGP1   CCAR1   SRRM1   CPSF7   PRPF38A   U2AF1L4   SNRNP27   PRPF31   CTNNBL1   DHX38   PRCC   SYMPK   GPKOW   CLP1   MAGOHB   PPWD1   SNRNP40   RBM17   CDC5L   HNRNPUL1   DDX23   SF3B5   UPF3B   CRNKL1   WDR33   CSTF2T   CWC22   XAB2   RBM22   CWC25   CWC15   CPSF2   PUF60   LSM7   CPSF3   ISY1   PRPF19   SRRM2   WBP11   LSM2   LSM5   LSM4   RBM8A  

Gene RIF (75)

PMID Text
26739063 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26587974 p53 gain-of-function mutations accelerate endometrial carcinoma progression and metastasis by interfering with Drosha and p68 binding and pri-miR-26a-1 processing, resulting in reduced miR-26a expression and EZH2 overexpression.
26469385 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
26362536 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
26314252 Cervical cancer cell DDX5 gene is transcriptionally upregulated by calcitriol through a VDRE located in its proximal promoter.
26312911 siRNA knockdown of DDX5 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV-1 demonstrates decreased infectivity.
26212035 DDX5 played an important role in the proliferation and tumorigenesis of non-small-cell lung cancer cells by activating the beta-catenin signaling pathway.
26209609 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box DDX5 and DDX17 RNA Helicases
26080402 study shows that correction of p68 may reduce toxicity of the mutant RNAs in DM1 and in DM2
26035968 DDX5 protein is essential for normal cell proliferation; (2) the transition from G1 to S/G2 phase is accompanied by an increase of DDX5 protein concentration in the cells.
More...

AA Sequence

MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA      1 - 70
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT     71 - 140
GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ    141 - 210
IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA    211 - 280
TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET    281 - 350
KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN    351 - 420
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK    421 - 490
DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT    491 - 560
GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ                    561 - 614
//

Publication (124)

PMID Year Title
26739063 2016 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26587974 2015 Mutant p53 induces EZH2 expression and promotes epithelial-mesenchymal transition by disrupting p68-Drosha complex assembly and attenuating miR-26a processing.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26314252 2015 The expression of RNA helicase DDX5 is transcriptionally upregulated by calcitriol through a vitamin D response element in the proximal promoter in SiHa cervical cells.
26212035 2015 DDX5 promotes proliferation and tumorigenesis of non-small-cell lung cancer cells by activating ?-catenin signaling pathway.
26209609 2015 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box (DDX)-5/17 RNA Helicases.
26080402 2015 Reduction of toxic RNAs in myotonic dystrophies type 1 and type 2 by the RNA helicase p68/DDX5.
26035968 2015 [The DDX5 protein is involved in cell proliferation and differentiation].
25963660 2015 Regulation of MicroRNA 183 by Cyclooxygenase 2 in Liver Is DEAD-Box Helicase p68 (DDX5) Dependent: Role in Insulin Signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...