Property Summary

NCBI Gene PubMed Count 106
Grant Count 22
R01 Count 13
Funding $1,773,633.74
PubMed Score 108.61
PubTator Score 103.84

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
atypical teratoid / rhabdoid tumor -1.400 0.000
glioblastoma -1.400 0.000
non-small cell lung cancer -1.318 0.000
diabetes mellitus -1.600 0.005
subependymal giant cell astrocytoma -1.271 0.009
ovarian cancer -2.200 0.000

Gene RIF (75)

PMID Text
26739063 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26587974 p53 gain-of-function mutations accelerate endometrial carcinoma progression and metastasis by interfering with Drosha and p68 binding and pri-miR-26a-1 processing, resulting in reduced miR-26a expression and EZH2 overexpression.
26469385 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
26362536 HIV-1 Gag interacts with RPS6 as demonstrated by proximity dependent biotinylation proteomics
26314252 Cervical cancer cell DDX5 gene is transcriptionally upregulated by calcitriol through a VDRE located in its proximal promoter.
26312911 siRNA knockdown of DDX5 decreases intra- and extra-cellular HIV CA(p24) from HeLa cells transfected with env-deleted HIV-1 plasmid, a vesicular stomatitis virus glycoprotein plasmid and specific siRNA. Resulting HIV-1 demonstrates decreased infectivity.
26212035 DDX5 played an important role in the proliferation and tumorigenesis of non-small-cell lung cancer cells by activating the beta-catenin signaling pathway.
26209609 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box DDX5 and DDX17 RNA Helicases
26080402 study shows that correction of p68 may reduce toxicity of the mutant RNAs in DM1 and in DM2
26035968 DDX5 protein is essential for normal cell proliferation; (2) the transition from G1 to S/G2 phase is accompanied by an increase of DDX5 protein concentration in the cells.
More...

AA Sequence

MSGYSSDRDRGRDRGFGAPRFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTA      1 - 70
QEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQT     71 - 140
GSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQ    141 - 210
IRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSA    211 - 280
TWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVET    281 - 350
KRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDVKFVINYDYPN    351 - 420
SSEDYIHRIGRTARSTKTGTAYTFFTPNNIKQVSDLISVLREANQAINPKLLQLVEDRGSGRSRGRGGMK    421 - 490
DDRRDRYSAGKRGGFNTFRDRENYDRGYSSLLKRDFGAKTQNGVYSAANYTNGSFGSNFVSAGIQTSFRT    491 - 560
GNPTGTYQNGYDSTQQYGSNVPNMHNGMNQQAYAYPATAAAPMIGYPMPTGYSQ                    561 - 614
//

Text Mined References (124)

PMID Year Title
26739063 2016 LMTK3 escapes tumour suppressor miRNAs via sequestration of DDX5.
26587974 2015 Mutant p53 induces EZH2 expression and promotes epithelial-mesenchymal transition by disrupting p68-Drosha complex assembly and attenuating miR-26a processing.
26420826 2015 Mammalian splicing factor SF1 interacts with SURP domains of U2 snRNP-associated proteins.
26314252 2015 The expression of RNA helicase DDX5 is transcriptionally upregulated by calcitriol through a vitamin D response element in the proximal promoter in SiHa cervical cells.
26212035 2015 DDX5 promotes proliferation and tumorigenesis of non-small-cell lung cancer cells by activating ?-catenin signaling pathway.
26209609 2015 Systematic Determination of Human Cyclin Dependent Kinase (CDK)-9 Interactome Identifies Novel Functions in RNA Splicing Mediated by the DEAD Box (DDX)-5/17 RNA Helicases.
26080402 2015 Reduction of toxic RNAs in myotonic dystrophies type 1 and type 2 by the RNA helicase p68/DDX5.
26035968 2015 [The DDX5 protein is involved in cell proliferation and differentiation].
25963660 2015 Regulation of MicroRNA 183 by Cyclooxygenase 2 in Liver Is DEAD-Box Helicase p68 (DDX5) Dependent: Role in Insulin Signaling.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
More...