Property Summary

NCBI Gene PubMed Count 359
Grant Count 248
R01 Count 134
Funding $32,920,683.01
PubMed Score 1147.63
PubTator Score 1538.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Synonym

Accession P17813 Q14248 Q14926 Q5T9C0
Symbols END
HHT1
ORW1

Gene

ENG

Gene RIF (335)

PMID Text
27352440 CD105 expression was detected in gastrectomy specimens.
27067789 Endoglin-induced peritoneal mesothelial cell senescence may contribute to peritoneal dissemination of gastric cancer cells
26646071 These results suggest a critical role for endoglin in integrin-mediated adhesion of mural cells.
26559253 A significant association of 6bINS allele with increased risk of familial intracranial aneurysm was detected . Also, we found that rs1800956 was significantly related to intracranial aneurysm occurrence.
26193208 The evaluation of both CD34-CD105 showed the role of angiogenesis in the cancer proliferation and local spread, the angiogenesis level being maintained high even in the advanced stages of the disease.
26191205 CD105+/CD90+ subpopulation from breast cancer MDA-MB-231 cells possesses "mesenchymal stem cell-like" characteristics, and its high migratory ability might be associated with epithelial-mesenchymal transformation.
26159901 YC-1 decreases placental production of sFlt-1 and sENG and decreases endothelial dysfunction. It is a novel therapeutic candidate for preeclampsia.
26078569 Suggest that endoglin expression correlates with prognosis in gastrointestinal stromal tumors.
26067657 CD105 and CD29 immunoexpression in decidua basalis, fetal membrane and placental villi showed significant negative correlations with the maternal age
25986715 The expression of DLL4 was positively correlated with CD105-labeled MVD.
More...

AA Sequence

MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLE      1 - 70
FPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPS     71 - 140
FPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE    141 - 210
GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK    211 - 280
IFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTC    281 - 350
SPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM    351 - 420
ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQL    421 - 490
DSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQ    491 - 560
DQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVA    561 - 630
APASSESSSTNHSIGSTQSTPCSTSSMA                                              631 - 658
//

Publication (361)

PMID Year Title
27352440 Correlations Between the Density of Tryptase Positive Mast Cells (DMCT) and that of New Blood Vessels (CD105+) in Patients with Gastric Cancer.
27067789 2016 Endoglin overexpression mediates gastric cancer peritoneal dissemination by inducing mesothelial cell senescence.
26646071 2016 Endoglin regulates mural cell adhesion in the circulatory system.
26559253 2015 Role of Endoglin Insertion and rs1800956 Polymorphisms in Intracranial Aneurysm Susceptibility: A Meta-Analysis.
26193208 2015 Comparative analysis of microvessel density quantified through the immunohistochemistry expression of CD34 and CD105 in rectal cancer.
26191205 2015 Isolation and characterization of CD105+/CD90+ subpopulation in breast cancer MDA-MB-231 cell line.
26159901 2015 YC-1 reduces placental sFlt-1 and soluble endoglin production and decreases endothelial dysfunction: A possible therapeutic for preeclampsia.
26078569 2015 Prognostic angiogenic markers (endoglin, VEGF, CD31) and tumor cell proliferation (Ki67) for gastrointestinal stromal tumors.
26067657 2015 Does the maternal age affect the mesenchymal stem cell markers and gene expression in the human placenta? What is the evidence?
25986715 2015 Overexpressions of DLL4 and CD105 are Associated with Poor Prognosis of Patients with Pancreatic Ductal Adenocarcinoma.
More...