Property Summary

NCBI Gene PubMed Count 390
PubMed Score 1235.88
PubTator Score 1538.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (7)

Disease Target Count Z-score Confidence
Telangiectasia, Hereditary Hemorrhagic 3 0.0 0.0
Disease Target Count
ANEURYSM, INTRACRANIAL BERRY, 1 (disorder) 3
Anemia 365
Aneurysm of celiac artery 1
Angioectasias of the lip 4
Angioectasias of the tongue 2
Arteriovenous Malformations, Cerebral 2
Arteriovenous fistulas of celiac and mesenteric vessels 3
Arteriovenous malformation of liver 2
Brain Abscess 2
Brain hemorrhage 14
Cerebral Hemorrhage 42
Cholecystitis 18
Clubbing 9
Conjunctival telangiectasis 14
Cyanosis 17
Dyspnea 76
Epilepsy 792
Epistaxis 43
Erythrocytosis 8
Familial primary pulmonary hypertension 11
Feces color: tarry 2
Finger pad telangiectases 2
Gastrointestinal angiodysplasia 3
Gastrointestinal arteriovenous malformation 2
Gastrointestinal telangiectasia 2
Hemangioma, Cavernous 20
Hematemesis 4
Hematochezia 9
Hemoglobin low 124
High-output congestive heart failure 1
Hypertension, Portal 22
Intermittent migraine headaches 68
Iron-Refractory Iron Deficiency Anemia 15
Ischemic stroke 4
Juvenile polyposis syndrome 7
Lip telangiectases 4
Liver Cirrhosis 181
Melena 2
Mesenteric artery aneurysm 1
Migraine Disorders 76
Nail bed telangiectases 2
Nasal mucosa telangiectasia 2
Palatal spider veins 2
Palate telangiectases 2
Polycythemia 25
Pulmonary arteriovenous malformation 2
Right to left cardiovascular shunt (finding) 3
Seizures 596
Spider veins of the lip 4
Spinal arteriovenous malformation 2
Spontaneous haematoma 8
Spontaneous, recurrent epistaxis 3
Subarachnoid Hemorrhage 7
Telangiectasia of the skin 39
Tongue telangiectasia 2
Transient Cerebral Ischemia 25
Venous varicosities of celiac and mesenteric vessels 1
Visceral angiomatosis 13
Disease Target Count Z-score Confidence
Metabolic syndrome X 52 0.0 1.7
Disease Target Count Z-score Confidence
Primary pulmonary hypertension 14 0.0 5.0

Expression

  Differential Expression (21)

Disease log2 FC p
astrocytoma 1.200 5.2e-03
COPD -1.100 7.0e-03
cystic fibrosis 1.270 1.2e-04
gastric carcinoma 1.200 1.3e-02
glioblastoma 1.100 2.5e-03
interstitial cystitis 1.300 3.5e-03
intraductal papillary-mucinous adenoma (... -1.100 1.0e-03
intraductal papillary-mucinous carcinoma... -1.200 8.9e-04
intraductal papillary-mucinous neoplasm ... -1.500 3.0e-03
invasive ductal carcinoma -1.100 3.3e-03
lung adenocarcinoma -1.100 1.4e-10
lung carcinoma -1.400 7.2e-10
non-small cell lung cancer -1.415 9.0e-16
osteosarcoma 1.206 3.0e-03
ovarian cancer 1.200 6.8e-04
pancreatic cancer 1.200 6.8e-04
primary pancreatic ductal adenocarcinoma 1.313 3.9e-04
subependymal giant cell astrocytoma 1.242 4.7e-02
tuberculosis -1.600 3.1e-08
ulcerative colitis 1.200 1.1e-03
urothelial carcinoma 1.300 3.2e-03

Gene RIF (365)

AA Sequence

MDRGTLPLAVALLLASCSLSPTSLAETVHCDLQPVGPERGEVTYTTSQVSKGCVAQAPNAILEVHVLFLE      1 - 70
FPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQALGIPLHLAYNSSLVTFQEPPGVNTTELPS     71 - 140
FPKTQILEWAAERGPITSAAELNDPQSILLRLGQAQGSLSFCMLEASQDMGRTLEWRPRTPALVRGCHLE    141 - 210
GVAGHKEAHILRVLPGHSAGPRTVTVKVELSCAPGDLDAVLILQGPPYVSWLIDANHNMQIWTTGEYSFK    211 - 280
IFPEKNIRGFKLPDTPQGLLGEARMLNASIVASFVELPLASIVSLHASSCGGRLQTSPAPIQTTPPKDTC    281 - 350
SPELLMSLIQTKCADDAMTLVLKKELVAHLKCTITGLTFWDPSCEAEDRGDKFVLRSAYSSCGMQVSASM    351 - 420
ISNEAVVNILSSSSPQRKKVHCLNMDSLSFQLGLYLSPHFLQASNTIEPGQQSFVQVRVSPSVSEFLLQL    421 - 490
DSCHLDLGPEGGTVELIQGRAAKGNCVSLLSPSPEGDPRFSFLLHFYTVPIPKTGTLSCTVALRPKTGSQ    491 - 560
DQEVHRTVFMRLNIISPDLSGCTSKGLVLPAVLGITFGAFLIGALLTAALWYIYSHTRSPSKREPVVAVA    561 - 630
APASSESSSTNHSIGSTQSTPCSTSSMA                                              631 - 658
//

Text Mined References (392)

PMID Year Title