Property Summary

NCBI Gene PubMed Count 31
PubMed Score 196.49
PubTator Score 30.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Breast cancer 1.300 5.1e-10
ductal carcinoma in situ 1.300 7.5e-05
group 3 medulloblastoma 1.500 5.4e-05
invasive ductal carcinoma 2.000 2.5e-04
lung cancer 2.100 4.7e-03
medulloblastoma, large-cell 2.200 3.7e-05
nasopharyngeal carcinoma 1.300 1.7e-06
non-small cell lung cancer 1.222 1.6e-14
ovarian cancer 1.800 2.7e-04
pancreatic ductal adenocarcinoma liver m... -1.549 4.2e-03
Pick disease -1.400 7.4e-06
psoriasis 1.100 2.6e-33
ulcerative colitis 1.200 7.4e-06

 OMIM Phenotype (1)

Gene RIF (10)

AA Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLD      1 - 70
LGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEP     71 - 140
QVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLS    141 - 210
PDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRK    211 - 280
MLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEE    281 - 350
PVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN    351 - 420
STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKK    421 - 490
CLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCR    491 - 560
LSPRDTYSDRSGSSSPDSEITELKFPSINHD                                           561 - 591
//

Text Mined References (46)

PMID Year Title