Property Summary

NCBI Gene PubMed Count 29
PubMed Score 173.29
PubTator Score 30.25

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
psoriasis 6685 3.38127565268946E-143
non-small cell lung cancer 2798 1.57394965247757E-14
Breast cancer 3099 5.09709863785916E-10
nasopharyngeal carcinoma 1056 1.72960862047198E-6
Pick disease 1893 7.37735475964337E-6
ulcerative colitis 2087 7.38212255496129E-6
medulloblastoma, large-cell 6234 3.73417913891787E-5
group 3 medulloblastoma 2254 5.38639315415756E-5
ductal carcinoma in situ 1745 7.50501880209607E-5
invasive ductal carcinoma 2950 2.45861848050757E-4
ovarian cancer 8492 2.69744309831679E-4
lung cancer 4473 5.99855088707706E-4
pancreatic ductal adenocarcinoma liver metastasis 1795 0.00424586920187572
Disease Target Count Z-score Confidence
Cerebral artery occlusion 3 3.051 1.5
Disease Target Count
Immunodeficiency 24 1

Expression

  Differential Expression (13)

Disease log2 FC p
group 3 medulloblastoma 1.500 0.000
medulloblastoma, large-cell 2.200 0.000
pancreatic ductal adenocarcinoma liver m... -1.549 0.004
non-small cell lung cancer 1.222 0.000
lung cancer 2.200 0.001
psoriasis 1.200 0.000
nasopharyngeal carcinoma 1.300 0.000
Pick disease -1.400 0.000
Breast cancer 1.300 0.000
ductal carcinoma in situ 1.300 0.000
invasive ductal carcinoma 2.000 0.000
ulcerative colitis 1.200 0.000
ovarian cancer 1.800 0.000

Synonym

Accession P17812 B4DR64 D3DPW1 Q5VW67 Q96GK6
Symbols CTPS
IMD24

Gene

PANTHER Protein Class (1)

PDB

2VO1  

  Ortholog (11)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG
Dog OMA EggNOG Inparanoid
Cow OMA EggNOG
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
C. elegans OMA EggNOG Inparanoid
S.cerevisiae OMA EggNOG

Gene RIF (8)

PMID Text
24870241 results highlight a key and specific role of CTPS1 in the immune system by its capacity to sustain the proliferation of activated lymphocytes during the immune response
24477477 Rods and rings (RR) are protein assemblies composed of CTPS1 and IMPDH2. Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
23166591 Expression of HIV-1 Tat upregulates the abundance of CTP synthase 1 (CTPS1) in the nucleoli of Jurkat T-cells
20739275 analysis of the kinetic properties of hCTPS1 and hCTPS2, and determination that Ser(68) is a major site of CTPS2 regulation by phosphorylation
18600551 studies provide novel information on the potential interacting proteins that may regulate CTPS1 function or intracellular localization
17681942 analysis of phosphorylation and regulation of human CTPS1 in human cells shows that GSK3 is a novel regulator of CTPS activity
17463002 Data indicate that protein kinase C phosphorylation at Ser(462) stimulates human CTP synthetase 1 activity, whereas phosphorylation at Thr(455) inhibits activity.
16179339 CTP synthetase is phosphorylated by protein kinase A

AA Sequence

MKYILVTGGVISGIGKGIIASSVGTILKSCGLHVTSIKIDPYINIDAGTFSPYEHGEVFVLDDGGEVDLD      1 - 70
LGNYERFLDIRLTKDNNLTTGKIYQYVINKERKGDYLGKTVQVVPHITDAIQEWVMRQALIPVDEDGLEP     71 - 140
QVCVIELGGTVGDIESMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELRGLGLS    141 - 210
PDLVVCRCSNPLDTSVKEKISMFCHVEPEQVICVHDVSSIYRVPLLLEEQGVVDYFLRRLDLPIERQPRK    211 - 280
MLMKWKEMADRYDRLLETCSIALVGKYTKFSDSYASVIKALEHSALAINHKLEIKYIDSADLEPITSQEE    281 - 350
PVRYHEAWQKLCSAHGVLVPGGFGVRGTEGKIQAIAWARNQKKPFLGVCLGMQLAVVEFSRNVLGWQDAN    351 - 420
STEFDPTTSHPVVVDMPEHNPGQMGGTMRLGKRRTLFQTKNSVMRKLYGDADYLEERHRHRFEVNPVWKK    421 - 490
CLEEQGLKFVGQDVEGERMEIVELEDHPFFVGVQYHPEFLSRPIKPSPPYFGLLLASVGRLSHYLQKGCR    491 - 560
LSPRDTYSDRSGSSSPDSEITELKFPSINHD                                           561 - 591
//

Text Mined References (44)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24870241 2014 CTP synthase 1 deficiency in humans reveals its central role in lymphocyte proliferation.
24477477 2014 Glutamine deprivation initiates reversible assembly of mammalian rods and rings.
24008161 2013 CTP synthase 1, a smooth muscle-sensitive therapeutic target for effective vascular repair.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22730407 2012 Introduction of a fluorine atom at C3 of 3-deazauridine shifts its antimetabolic activity from inhibition of CTP synthetase to inhibition of orotidylate decarboxylase, an early event in the de novo pyrimidine nucleotide biosynthesis pathway.
22220215 2011 Induction of cytoplasmic rods and rings structures by inhibition of the CTP and GTP synthetic pathway in mammalian cells.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
21150319 2010 Proteomic profiling of Myc-associated proteins.
More...