Property Summary

NCBI Gene PubMed Count 101
Grant Count 12
Funding $674,406.17
PubMed Score 36.67
PubTator Score 51.33

Knowledge Summary

Patent (1,636)

Expression

  Differential Expression (8)

Disease log2 FC p
osteosarcoma 1.313 0.000
ependymoma -1.200 0.000
atypical teratoid / rhabdoid tumor -1.600 0.000
glioblastoma -1.400 0.000
adult high grade glioma -1.200 0.000
pilocytic astrocytoma -1.100 0.000
lung adenocarcinoma 1.100 0.000
lung carcinoma 1.800 0.000

Gene RIF (93)

PMID Text
26644472 the identity of subunits neighboring the otherwise equivalent alpha4(+)/(-)beta2 agonist sites modifies their contributions to nAChR activation and E-loop residues are an important contributor to this neighbor effect
25869137 analysis of how an agonist to the binding site promotes activation of alpha4beta2* nicotinic acetylcholine receptors
25640319 The results of this study suggested that rs2072660 had a significant effect on the nicotine dependence There was no direct association between depressive phenotype (with neither ZSDS total scores and nor its subscales) and CHRNB2 variants.
25068303 Data show efficient expression of (alpha6beta2)2beta3 nicotinic acetylcholine receptors (AChRs) in Xenopus oocytes using free subunits with only small changes in alpha6 subunits, while not altering AChR pharmacology or channel structure.
24982426 Data indicate the binding mode and modulatory mechanism of NS9283 at alpha4beta2 nicotinic acetylcholine receptors.
24850280 Smokers with less upregulation of available alpha4beta2* nAChRs have a greater likelihood of quitting with treatment than smokers with more upregulation.
23734673 Data indicate that compounds showed favorable subtype selectivity for beta2*-nAChRs over beta4*-nAChRs.
23437071 alpha4beta2-nAChR is a sensitive target to mediate oligomeric alpha-synuclein-induced modulation of cholinergic signaling.
23429692 Following smoking reduction and cessation alpha4beta2* nAChR densities were decreased across brain regions.
23037950 findings suggest that CHRNB2 rs4845652 T-allele carriers may be associated with lower levels of nicotine dependence (ND), and that certain allelic combinations of CHRNA4 and CHRNB2 might be correlated with higher ND levels.
More...

AA Sequence

MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV      1 - 70
HEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYD     71 - 140
GSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPG    141 - 210
RRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFL    211 - 280
LLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQ    281 - 350
QPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC    351 - 420
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTT    421 - 490
FLHSDHSAPSSK                                                              491 - 502
//

Text Mined References (103)

PMID Year Title
26644472 2016 Differential ?4(+)/(-)?2 Agonist-binding Site Contributions to ?4?2 Nicotinic Acetylcholine Receptor Function within and between Isoforms.
25869137 2015 An Accessory Agonist Binding Site Promotes Activation of ?4?2* Nicotinic Acetylcholine Receptors.
25640319 2015 The possible role of maternal bonding style and CHRNB2 gene polymorphisms in nicotine dependence and related depressive phenotype.
25068303 2014 Efficient expression of functional (?6?2)2?3 AChRs in Xenopus oocytes from free subunits using slightly modified ?6 subunits.
24982426 2014 Structural and functional studies of the modulator NS9283 reveal agonist-like mechanism of action at ?4?2 nicotinic acetylcholine receptors.
24850280 2014 Brain nicotinic acetylcholine receptor availability and response to smoking cessation treatment: a randomized trial.
23734673 2013 Chemistry, pharmacology, and behavioral studies identify chiral cyclopropanes as selective ?4?2-nicotinic acetylcholine receptor partial agonists exhibiting an antidepressant profile. Part II.
23437071 2013 Human ?4?2 nicotinic acetylcholine receptor as a novel target of oligomeric ?-synuclein.
23429692 2013 Treatment for tobacco dependence: effect on brain nicotinic acetylcholine receptor density.
23037950 2013 Possible association of nicotinic acetylcholine receptor gene (CHRNA4 and CHRNB2) polymorphisms with nicotine dependence in Japanese males: an exploratory study.
More...