Property Summary

Ligand Count 2
NCBI Gene PubMed Count 110
PubMed Score 37.56
PubTator Score 51.33

Knowledge Summary

Patent (1,636)

Expression

  Differential Expression (8)

Disease log2 FC p
adult high grade glioma -1.200 2.9e-05
Astrocytoma, Pilocytic -1.200 4.0e-07
atypical teratoid / rhabdoid tumor -1.600 6.2e-09
ependymoma -1.200 4.5e-11
glioblastoma -1.400 5.9e-06
lung adenocarcinoma 1.100 5.1e-05
lung carcinoma 1.800 2.9e-45
osteosarcoma 1.313 2.5e-06

Gene RIF (100)

AA Sequence

MARRCGPVALLLGFGLLRLCSGVWGTDTEERLVEHLLDPSRYNKLIRPATNGSELVTVQLMVSLAQLISV      1 - 70
HEREQIMTTNVWLTQEWEDYRLTWKPEEFDNMKKVRLPSKHIWLPDVVLYNNADGMYEVSFYSNAVVSYD     71 - 140
GSIFWLPPAIYKSACKIEVKHFPFDQQNCTMKFRSWTYDRTEIDLVLKSEVASLDDFTPSGEWDIVALPG    141 - 210
RRNENPDDSTYVDITYDFIIRRKPLFYTINLIIPCVLITSLAILVFYLPSDCGEKMTLCISVLLALTVFL    211 - 280
LLISKIVPPTSLDVPLVGKYLMFTMVLVTFSIVTSVCVLNVHHRSPTTHTMAPWVKVVFLEKLPALLFMQ    281 - 350
QPRHHCARQRLRLRRRQREREGAGALFFREAPGADSCTCFVNRASVQGLAGAFGAEPAPVAGPGRSGEPC    351 - 420
GCGLREAVDGVRFIADHMRSEDDDQSVSEDWKYVAMVIDRLFLWIFVFVCVFGTIGMFLQPLFQNYTTTT    421 - 490
FLHSDHSAPSSK                                                              491 - 502
//

Text Mined References (114)

PMID Year Title