Property Summary

Ligand Count 122
NCBI Gene PubMed Count 217
PubMed Score 772.29
PubTator Score 190.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
colon cancer -1.500 5.5e-03
cutaneous lupus erythematosus -1.100 2.9e-02
group 3 medulloblastoma 1.800 1.6e-02
lung cancer 3.400 9.8e-06
lung carcinoma 6.700 2.4e-52
medulloblastoma, large-cell 5.900 3.1e-07
osteosarcoma -3.079 2.8e-11
psoriasis -2.300 3.9e-04

Protein-protein Interaction (4)

Gene RIF (253)

AA Sequence

MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINR      1 - 70
EQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNV     71 - 140
YRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDN    141 - 210
IPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPL    211 - 280
LAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAK    281 - 350
VKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA    351 - 420
MNELQHDLDVVSDALAKVSRKPSI                                                  421 - 444
//

Text Mined References (217)

PMID Year Title