Property Summary

NCBI Gene PubMed Count 207
Grant Count 290
R01 Count 177
Funding $32,471,634.52
PubMed Score 740.67
PubTator Score 190.04

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
cutaneous lupus erythematosus -1.100 0.029
psoriasis -2.300 0.000
osteosarcoma -3.079 0.000
medulloblastoma, large-cell 5.900 0.000
lung cancer 4.700 0.000
colon cancer -1.500 0.005
group 3 medulloblastoma 1.800 0.016
lung carcinoma 6.700 0.000

Synonym

Accession P17752 D3DQX6 O95188 O95189 Q16736 Q3KPG8
Symbols TPRH
TRPH

Gene

PDB

1IN9   1MLW   3HF6   3HF8   3HFB   5J6D  

Gene RIF (243)

PMID Text
26710093 Polymorphisms in the TPH1 gene may be represented by diminished activity in lateral areas of the PFC underlying response inhibition.
26238767 Decoy receptor 3 regulates the expression of tryptophan hydroxylase 1 in rheumatoid synovial fibroblasts
25861735 TPH1 is functionally expressed in human coronary artery smooth muscle cells.
25842846 TPH1 gene polymorphism rs1800532 C>A is associated with the risk of paranoid schizophrenia in Russians and Tatars.
25428414 TPH1 gene polymorphisms and S100A10 expression, which correlate with 5-HT signaling were associated with ramosetron effectiveness in IBS-D, and may possibly lead to prospective identification of the resistance to treatment.
25419635 This review showed no evidence for the association of antidepressant response with an A218C SNP in the TPH1 gene.
25005534 The study provides evidence that A218C/A779C TPH-1 variants may be a risk factor to manifest suicidal behavior at the clinical level, which is in agreement with previously reported meta-analyses.[review and meta-analysis]
24903772 Results suggest that TPH1 218A/C and HTR5A 12A/T polymorphisms cannot predict treatment response in major depression
24468700 Tph1 and increased EC cell number occurred before the onset of obesity and hyperleptinemi. In addition, leptin deficiency was associated with reduced Pax4 mRNA, oral leptin treatment enhanced both Tph1 and Pax4 mRNA.
24280759 HTTLPR may mediate the risk for SMB through modulation of some temperamental traits.
More...

AA Sequence

MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINR      1 - 70
EQLNDIFHLLKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDHCANRVLMYGSELDADHPGFKDNV     71 - 140
YRKRRKYFADLAMNYKHGDPIPKVEFTEEEIKTWGTVFQELNKLYPTHACREYLKNLPLLSKYCGYREDN    141 - 210
IPQLEDVSNFLKERTGFSIRPVAGYLSPRDFLSGLAFRVFHCTQYVRHSSDPFYTPEPDTCHELLGHVPL    211 - 280
LAEPSFAQFSQEIGLASLGASEEAVQKLATCYFFTVEFGLCKQDGQLRVFGAGLLSSISELKHALSGHAK    281 - 350
VKPFDPKITCKQECLITTFQDVYFVSESFEDAKEKMREFTKTIKRPFGVKYNPYTRSIQILKDTKSITSA    351 - 420
MNELQHDLDVVSDALAKVSRKPSI                                                  421 - 444
//

Text Mined References (207)

PMID Year Title
26710093 2016 Tryptophan hydroxylase 1 gene polymorphisms alter prefrontal cortex activation during response inhibition.
26238767 2015 Decoy receptor 3 regulates the expression of tryptophan hydroxylase 1 in rheumatoid synovial fibroblasts.
25861735 2015 Functional constituents of a local serotonergic system, intrinsic to the human coronary artery smooth muscle cells.
25842846 [The association of polymorphisms in SLC18A1, TPH1 and RELN genes with risk of paranoid schizophrenia].
25428414 2015 Pilot study of Biomarkers for predicting effectiveness of ramosetron in diarrhea-predominant irritable bowel syndrome: expression of S100A10 and polymorphisms of TPH1.
25419635 2015 Association between the TPH1 A218C polymorphism and antidepressant response: evidence from an updated ethnicity, antidepressant-specific, and ethnicity-antidepressant interaction meta-analysis.
25005534 2014 Association of TPH-1 and TPH-2 gene polymorphisms with suicidal behavior: a systematic review and meta-analysis.
24903772 2014 Serotonin-related polymorphisms in TPH1 and HTR5A genes are not associated with escitalopram treatment response in Korean patients with major depression.
24468700 2014 Overexpression of gastric leptin precedes adipocyte leptin during high-fat diet and is linked to 5HT-containing enterochromaffin cells.
24280759 2013 Temperamental and genetic predictors of suicide attempt and self-mutilation.
More...